Conserved Protein Domain Family
ComEB

?
TIGR02571: ComEB 
ComE operon protein 2
This protein is found in the ComE operon for "late competence" as characterized in B. subtilis. Proteins in this family contain homology to a cytidine/deoxycytidine deaminase domain family (pfam00383), and may carry out this activity.
Statistics
?
PSSM-Id: 131622
View PSSM: TIGR02571
Aligned: 4 rows
Threshold Bit Score: 296.386
Threshold Setting Gi: 27315739
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAT63570       2 ERISWDQYFMTQSHLLSLRSTCTRLAVGATIVRDKRIIAGGYNGSIKGGVHCIDDGCYVIDNHCVRTIHAEMNALLQCAK 81  Bacillus thurin...
AAO04874       2 ERIKWEEYFMAQSHLLALRSTCKRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLIEDGHCIRTIHAEMNALLQCAK 81  Staphylococcus ...
CAD64491       5 QRIPWDQYFMMQAVLLASRSTCERLSVGATIVRDKRIIAGGYNGSVSGDVHCIDEGCYLVDGHCVRTIHAEMNAILQCAK 84  Lactobacillus p...
WP_003766932   2 QRIAWDQFFMAQSHLISSRSTCTRLMVGATIVRDKRIIAGGYNGSIAGGDHCAEHGCYVVDGHCIRTIHAEMNAILQCAK 81  Listeria innocua
AAT63570      82 FGVKTEEAEIYVTHFPCLQCCKAIIQSGITAVYYAQDYKNHPYAVELFEKANVTVKHVPLEYDIAALEDQK 152 Bacillus thuringiensis s...
AAO04874      82 QGVSTEGATIYVTHFPCLNCTKSIIQAGIKTIYYAQDYHNNDYAIKLLKQSGIEYKKIPFSPEYVAQYLTQ 152 Staphylococcus epidermid...
CAD64491      85 FGAATDGAEIYVTDFPCLQCTKMLLQAGIQKIHYLRNYHNDAYAMSLIERKHVALQQVQFDQSDLDKLNLD 155 Lactobacillus plantarum ...
WP_003766932  82 FGASTDKAELYVTHFPCLACTKSIIQAGIKKVYFAKDYKNHPYALELFNIAGVELQKVEFDESVLQVNNWN 152 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap