Conserved Protein Domain Family

TIGR02569: TIGR02569_actnb 
TIGR02569 family protein
This protein family is found, so far, only in Actinobacteria, including as least five species of Mycobacterium, three of Corynebacterium, and Nocardia farcinica, always in a single copy per genome. The function is unknown. [Hypothetical proteins, Conserved]
PSSM-Id: 131620
Aligned: 3 rows
Threshold Bit Score: 413.609
Threshold Setting Gi: 41324998
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAF19479      83 SVFSTGTISKRVDETVVAGLRLADALVDTHAP-----EPVDN-----VFNRADVQAWEEQP------------------- 133 Corynebacterium...
CAE49243      84 NSFEEGTLARRVDETVVAALRLDTALADIDVP-----DSFSEpdshdLFSLADHSAWAPEPmvalgvtsdaeavflnpaq 158 Corynebacterium...
WP_003899969  92 DTFVAGAPEPRHDEVVSAAVRLHEATGKLERPrfltqGPAAPwaeidVFVAADRAGWEERPlqsvppgvptap--paadp 169 Mycobacterium t...
CAF19479     207 PEIEQLVLRAFLFRRNLQEFSENNDPNVISNLNRVESTL 245 Corynebacterium glutamicum ATCC 13032
CAE49243     239 QHRDQLLLRALVYRIAVHALHPESTSNTGTNLEWVSQTI 277 Corynebacterium diphtheriae
WP_003899969 250 PEWPQMLLRALMFRLAVYALHPRSTAEAFPGLAHTAALV 288 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap