Conserved Protein Domain Family
YscW

?
TIGR02567: YscW 
type III secretion system chaperone YscW
This family of proteins is found within type III secretion operons. The protein has been characterized as a chaperone for the outer membrane pore component YscC (TIGR02516). YscW is a lipoprotein which is itself localized to the outer membrane and, it is believed, facilitates the oligomerization and localization of YscC.
Statistics
?
PSSM-Id: 131618
View PSSM: TIGR02567
Aligned: 4 rows
Threshold Bit Score: 156.156
Threshold Setting Gi: 12644658
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC59963       8 GLIGLMLLTGCAQsvgtsQPFSVQSQANVYGWISVEgYHPPVSTYIEVEMCQDFENQCLTVASQQYQGVQLPVQYSFLIA 87  Vibrio parahaem...
CAE16123       6 LVLLCLLMTGCVS-----EAIEHEASRLIEGDVTMR-ASLPRTANVEVSLLTVVEGKVLTVGEMHYRLDMLPVTFSMRLN 79  Photorhabdus lu...
P26994         2 LLPLALLLGGCVS-----QPAPMSPKVTVGGSVGGV-SLQARQAQLRLRLYAVVQGRMQTIAERRYRVSGLPLRYAFDLE 75  Pseudomonas aer...
WP_002222527   6 ALIISFLLVGCAT-----PPMPAQR---IVGEVRMS-RPLSRIAHIDVSMFGLYEGKVREVQRTHFETGNLPLFFSIKLN 76  Yersinia
BAC59963      88 PiQAGKGEMKVIGKLYSQGQIIAQNEQKYIFREGsQKVDLRLFPIEIETKK 138 Vibrio parahaemolyticus RIMD 2210633
CAE16123      80 P-QFSHGELFLRARLRWDGKRAVQAKSQQRIIAG-KRIVVQLSPLPCYPEC 128 Photorhabdus luminescens subsp. laumondii TTO1
P26994        76 VdRLEGEALYLRTELSWVGVAAVQASAWQQVAAG-VDERVRLVRRDCFPNC 125 Pseudomonas aeruginosa PAO1
WP_002222527  77 PaQRGEGELYLRSTLSFP-ERGVQAVAQQKLTGK-NKVVLQMIPKTCYPNC 125 Yersinia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap