Conserved Protein Domain Family
HrpB7

?
TIGR02559: HrpB7 
type III secretion protein HrpB7
This family of genes is found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia.
Statistics
?
PSSM-Id: 131610
View PSSM: TIGR02559
Aligned: 4 rows
Threshold Bit Score: 94.6255
Threshold Setting Gi: 52213065
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAH39103   4 RQQRAFETLLARRAQRGERLRAEQRVLRAERDAAAAELAQGEAHAHAKRDAANRYAERVDAMAAGRAPFTIGDYAACRRY 83  Burkholderia pseudo...
CAH38868   5 RRAMAFARALERRRRLDAVLREELAERRTRLQSLDRVLKEKVSQVELKADDVHRHAARIDTLMTGTASFSLDELTACRAY 84  Burkholderia pseudo...
CAD18022   5 RRSSVWRALIEAKTRERRRVEADIEAAQAALAEAQTAVEARQDALRQAEQRLDDHLRSMDDLTTG-PSLTAQAYLQYDAY 83  Ralstonia solanacea...
AAM40535   3 ERVSTWRTLQQLKTRRYQRMQDHLSDCRRALEQCDGERASCSQQADACTTRLAAFDAALADTAGAGEPIGIEAILQHQRF 82  Xanthomonas campest...
CAH39103  84 RDALLDEHALASAQCARLRAALQAKVDRLAATARRIARNDAQIDVVRERIRRLARAAEAAAEDAHDEEIEEGVLARRL 161 Burkholderia pseudoma...
CAH38868  85 LDVAVAHLRALESEEARLRAEFDALAAAIEEKKLEIGRNLSRIDACDARIEQIRRHGERAADEALDEEMEEAALGARM 162 Burkholderia pseudoma...
CAD18022  84 RTQLEGGVGQAEQAVAAAQGVVAEREAALQAQRRKLARLDAMLERCRETADRLDRKEDAERELATEEEAVEAILARAR 161 Ralstonia solanacearu...
AAM40535  83 RAVLEERCGAAEQALVAATQALQRAHDEVATVQQTVSRLEAQAQVYAEKAARARRAWQAQREAAEEEDAIEALIGLRL 160 Xanthomonas campestri...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap