Conserved Protein Domain Family
HrpB2

?
TIGR02558: HrpB2 
type III secretion protein HrpB2
This family of genes is found in type III secretion operons in a narrow group of species including Xanthomonas, Burkholderia and Ralstonia.
Statistics
?
PSSM-Id: 131609
View PSSM: TIGR02558
Aligned: 4 rows
Threshold Bit Score: 120.796
Threshold Setting Gi: 52422389
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAH38873        5 VSRTALQLSLEQLTNGTaGNTPAHLAEKFSALMRKAPMEPVQAPRSAGLETVSRLAAAQDMELQRSVSDVADVERRAPML 84  Burkholderia p...
AAM40530        8 VPITASTGLSTPAVSPT-AAPNQSLVNRFQALMQSSCPLPPAMQRVGEPSMISRMVDMQNDGVRAMTEHVDAFGANAPKM 86  Xanthomonas ca...
2113360M        8 VPPVPTHSVDTPALPAVqPEPVQELVSRFEALLG---QAKDAQRHSKGPSAIGELVAKEDAAVRATADRINATLETDKVK 84  Ralstonia sola...
tigr:BMAA1633  16 VAFSDAAAAPAGAGAPAaAPVPAEVAGRFQALMSN-AVPTPPLAHAQETSAIAKLVETSDAEIRKVLDNVEYLNLHANEM 94  Burkholderia m...
CAH38873       85 SLSEVNVETIRLTYEIASTQLDMEAKMSVVNASKTAIETLMKNQ 128 Burkholderia pseudomallei K96243
AAM40530       87 GLEEIAAEEMKLINELTMVGFNLNVSVSLAQSGKNAVQTLFKNQ 130 Xanthomonas campestris pv. campestris str. ATCC 33913
2113360M       85 PMEEILVDAMRIQMEAAATMTKIHMGSMVAHSGKNAVQTLMKNQ 128 Ralstonia solanacearum
tigr:BMAA1633  95 TMNQMFAASLQASAEATAMQIDMQAKMGVVTSTKDAIGSLMKNQ 138 Burkholderia mallei ATCC 23344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap