Conserved Protein Domain Family
PrgH

?
TIGR02554: PrgH 
type III secretion system protein PrgH/EprH
In Samonella, this gene is part of a four-gene operon PrgHIJK and in general is found in type III secretion operons. PrgH has been shown to be required for secretion, as well as being a structural component of the needle complex. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131605
View PSSM: TIGR02554
Aligned: 3 rows
Threshold Bit Score: 553.365
Threshold Setting Gi: 52422293
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BMAA1547   5 DSGLEALQLRILFGPLFGSDIAIPSGEVFFCVGEQVIDDRPAEHPenraghllERAVDTLYIPHRAGAPNFRLRFPgapt 84  Burkholderia m...
WP_000450189    9 ITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLP--------DIPADSFFIPLDHGGVNFEIQVD---- 76  Salmonella ent...
WP_011135970    6 TSGRDAVVVRLLNSPLRGCEFTLQPGKTLFLVGPESALAADGLPP--------ELPADSLFVPLAEGGVNFELLLD---- 73  Chromobacteriu...
tigr:BMAA1547  85 qaartaetgeAASGDFEVDFLSADGCVTQRAAFNTVCRFGDLAFALRRQREPWSEAVMHYAPHAPSRAADAAEPGapgep 164 Burkholderia m...
WP_000450189   77 ----------TDATEIILHELKEGNPESRSVQLNTPIQVGELLILIRPESEPWVPEQPEKLETSAKKNEPRFKNG----- 141 Salmonella ent...
WP_011135970   74 ----------NGCAR--LRILGDEVTES-EAPFNQPLSVGALRLALRPQHLPWQAEILNGFEPTGAPAAPSSATPgra-- 138 Chromobacteriu...
tigr:BMAA1547 165 gdggerasrFALKLGALLVAGVALAALAYWQVQryvGAQKLASVNGVLAGAPVPNAILPGDDGRIYVLSASQDGAEWDRE 244 Burkholderia m...
WP_000450189  142 ---------IVAALAGFFILGIGTVGTLWILNS---PQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQ 209 Salmonella ent...
WP_011135970  139 -------grALLALGALCAVALLAAGGHWLWNS---QQRQVAELSALLGDDGQRFHVLPGRDGVYYVAAADARDGVWARQ 208 Chromobacteriu...
tigr:BMAA1547 245 ALLKAALPEKIEVAVIGAERQRVERRLDEAG--VDFVTVRLDAPEHPELILTG---AAPAAARARAIGELRRAAPYVRDV 319 Burkholderia m...
WP_000450189  210 VLARGDYDKNARVINENEENKRISTWLDTYYpqLAYYRLHFDEPRKPVFWLSRqrnTMSKKELEVLSQKLRALMPYADSV 289 Salmonella ent...
WP_011135970  209 SLLRAEFRQPVQIVEPAGESERVSRWLSESRpeLAFYRLLLDDPRRPQLWISRqrsPLDEASRQKLASQLSVLMPYAERV 288 Chromobacteriu...
tigr:BMAA1547 320 RVIDASLGAIEQEARNALDKVGARYRLLARRGGATFEVASSFGDEELAALQNLMRSFGHKWGTRRVDFKIALRTDWLKGK 399 Burkholderia m...
WP_000450189  290 NITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGR 369 Salmonella ent...
WP_011135970  289 SIVPVDDEAASRQAEEGLSRQALPFTRNDQRDSVTFVIAGALDDGELQRARQFVDAYYRQWGGRYVQFAIELKDDWLKGK 368 Chromobacteriu...
tigr:BMAA1547 400 SYREGGDGYVLLDHASWYFPQPL 422 Burkholderia mallei ATCC 23344
WP_000450189  370 SFQYGAEGYIKMSPGHWYFPSPL 392 Salmonella enterica
WP_011135970  369 SFKYGSQGYVKLNSGHWYFPKPL 391 Chromobacterium violaceum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap