2P31,3CYN


Conserved Protein Domain Family
gpx7

?
TIGR02540: gpx7 
Click on image for an interactive view with Cn3D
putative glutathione peroxidase Gpx7
This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Statistics
?
PSSM-Id: 131592
View PSSM: TIGR02540
Aligned: 9 rows
Threshold Bit Score: 305.992
Threshold Setting Gi: 28278471
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P31_A    28 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESF 107 human
AAH29424  46 SFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESF 125 human
AAH70970  46 DFYSYEVTDAKGRAVALSKYRGKASLVVNVASGCPHAEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNQEIGAL 125 African clawed frog
AAH46044  47 DFYSYEVKDARGRTVSLEKYRGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREIEAF 126 zebrafish
Q96SL4    24 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESF 103 human
Q99LJ6    23 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENF 102 house mouse
AAH82680  21 DFYTFKVVNIRGKLVSLEKYRGSVTLVVNVASECGFTDSHYKALQQLQRDLGSHHFNVLAFPCNQFGQQEPNSDREIENF 100 African clawed frog
AAH19664  46 SFYSFEVKDAKGRTVSLEKFKGKASLVVNVASDCRFTDKSYQILRELHKEFGPYHFNVLAFPCNQFGESEPKSSKEVESF 125 house mouse
3CYN_A    26 SFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESF 105 human
2P31_A   108 ARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALV 180 human
AAH29424 126 ARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALV 198 human
AAH70970 126 AKRNYGVTFPMFSKIKILGSEAEPAYRFLVDSTKKEPRWNFWKYLVDPQGQVVKYWRPDETAESIRPEVASLV 198 African clawed frog
AAH46044 127 AKSNYGVTFPIFNKIKIMGSEAEPAFRFLTDSVQKIPRWNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLV 199 zebrafish
Q96SL4   104 ARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALV 176 human
Q99LJ6   103 ARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQV 175 house mouse
AAH82680 101 VRKNYSASFPMFSKTAVTGSGANTAFKYLIESSGKEPDWNFWKYLVGPEGKVVDAWGPTVSVAEVRPHITSLV 173 African clawed frog
AAH19664 126 ARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPLEAIRPHVSQMI 198 house mouse
3CYN_A   106 ARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALV 178 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap