3I4K


Conserved Protein Domain Family
mucon_cyclo

?
TIGR02534: mucon_cyclo 
Click on image for an interactive view with Cn3D
muconate and chloromuconate cycloisomerases
This model encompasses muconate cycloisomerase (EC 5.5.1.1) and chloromuconate cycloisomerase (EC 5.5.1.7), enzymes that often overlap in specificity. It excludes more distantly related proteins such as mandelate racemase (5.1.2.2).
Statistics
?
PSSM-Id: 162905
View PSSM: TIGR02534
Aligned: 6 rows
Threshold Bit Score: 601.783
Threshold Setting Gi: 6014742
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3I4K_A     8 IQKVESRILDVPLIRPHGFATTTSTEQHILLVSVHLENGVIGYGEGVVPGGPWWGGESVETXKALVDGYLAPVLIGRAVS 87  Corynebacterium glu...
CAE53842   6 IVSIETTILDVPLVRPHKFATTSMTAQPLLLVAIRTSDGVIGYGEGVVPGGPWWGGESVETMQVIIEKYIAPVVVGRRVD 85  Rhodococcus erythro...
CAF21066   6 IQKVESRILDVPLIRPHGFATTTSTEQHILLVSVHLENGVIGYGEGVVPGGPWWGGESVETMKALVDGYLAPVLIGRAVS 85  Corynebacterium glu...
BAB21460   5 ITSVEAILVDLPTIRAHQLAMATMQQQTLVIVRLRTSDGIEGIGEATTIGGLSHGDESPEGIKLTIDTYLAPALVGQDAT 84  Burkholderia sp. NK8
O33949     8 IESVETILVDVPTIRPHRLSVATMNCQTLVLVRIRCADGVVGVGEGTTIGGLAYGEESPESIKVNIDTYFAPLLKGLDAT 87  Acinetobacter lwoffii
CAG68309   2 YKSVETILVDIPTIRPHKLSVTTMQTQTLVLIKIITEDGIVGWGEATTIGGLNYGEESPESVKANIDTYFKPLLLSIKAP 81  Acinetobacter sp. ADP1
3I4K_A    88 E-LAGIXADLERVVARARYAKAAVDVAXHDAWARSLNVPVRDLLGGTVRDKVDVTWALGVLPLDVAVAEIEERIEEFGNR 166 Corynebacterium glu...
CAE53842  86 Q-ITAIMADIEKVVANARFAKAAVDVALHDAWARSLGVPVHTLLGGAFRESVDVTWALGAAPADEIIEEAHEKLESRLNF 164 Rhodococcus erythro...
CAF21066  86 E-LAGIMADLERVVARARYAKAAVDVAMHDAWARSLNVPVRDLLGGTVRDKVDVTWALGVLPLDVAVAEIEERIEEFGNR 164 Corynebacterium glu...
BAB21460  85 N-INAAMLRLNKIARGNRFAKCAMETALLDAQGKRLGVPVCELLGGAVRKTLPVLWTLASGDTQRDIEEAEMLLAERRHH 163 Burkholderia sp. NK8
O33949    88 R-PGAAMATLRGLFQGNRFARSAVETALFDAQAQRLGVPLSELFGGRIRDSVDVAWTLASGDTTRDIDEAERVFEAKRHR 166 Acinetobacter lwoffii
CAG68309  82 LnVAQTLKLIRKSINGNRFAKCAIQTALLEIQAKRLNVPVSELLGGRIRDRLPVLWTLASGDTDKDIAEAKKMIELKRHN 161 Acinetobacter sp. ADP1
3I4K_A   167 SFKLKXGAGDPAEDTRRVAELAREVGDRVSLRIDINARWDRRTALHYLPILAEAGVELFEQPTPADDLETLREITRRTNV 246 Corynebacterium glu...
CAE53842 165 SFKLKMGALDPAVDVARIVSIAQALDGHAGVRVDVNARWDRFTALRYLPQLADGGVELIEQPTPADQIEVLAELSRLLPI 244 Rhodococcus erythro...
CAF21066 165 SFKLKMGAGDPAEDTRRVAELAREVGDRVSLRIDINARWDRRTALHYLPILAEAGVELFEQPTPADDLETLREITRRTNV 244 Corynebacterium glu...
BAB21460 164 TFKLKIGRRSVRDDVAHVSQIKAALGDRAKVTVDVNQAWNEADAALGIEALQAAGIDLIEQPTPREQRGALARLAARFIV 243 Burkholderia sp. NK8
O33949   167 VFKLKIGSRALADDVAHVVAIQKALQGRGEVRVDVNQAWTESEAIWAGKRFADASVALIEQPIAAENRAGLKRLTDLAQV 246 Acinetobacter lwoffii
CAG68309 162 TFKLKIGSNPLQHDVDHVIAIKKALGPEISVRVDVNRAWSELECVKGIQQLQDGGIDLIEQPCAIENTDALARLTARFDV 241 Acinetobacter sp. ADP1
3I4K_A   247 SVXADESVWTPAEALAVVKAQAADVIALKTTKHGGLLESKKIAAIAEAGGLACHGATSLEGPIGTAASLQFAASTKAISY 326 Corynebacterium glu...
CAE53842 245 PIMADESVQTPHDALEIARRSAADVIALKTTKCGGLQRSRDIVAIAKAAGIACHGATSIEGPIGTAASLHFACAEPGINF 324 Rhodococcus erythro...
CAF21066 245 SVMADESVWTPAEALAVVKAQAADVIALKTTKHGGLLESKKIAAIAEAGGLACHGATSLEGPIGTAASLQFAASTKAISY 324 Corynebacterium glu...
BAB21460 244 PIMADEAVTGPEDALELVRHACADVFALKIAKSGGIYGMMRTAAIADAAGVSLYGGTMLEGSIGSIASAHGFAALPQLTW 323 Burkholderia sp. NK8
O33949   247 PIMADEALHGPADAFALASARAADVFAVKIAQSGGLSGAANVAAIALAANIDLYGGTMLEGAVGTIASAQLFSTFGELKW 326 Acinetobacter lwoffii
CAG68309 242 AIMADEVLTGPDSAYRIAKKSGADVFAVKVEQSGGLIEACEVAKIARLAGISLYGGTMLEGPVGSIASAHAFSTFETLEF 321 Acinetobacter sp. ADP1
3I4K_A   327 GTELFGPQLLKDTYIVQEFEYKDGQVAIPQGPGLGVDVDXDKVNFYTRK 375 Corynebacterium glutamicum
CAE53842 325 GTELFGPLLFSEELLQEPLKYSEGQLHLPAGPGLGVELNMDAVKTWTRN 373 Rhodococcus erythropolis
CAF21066 325 GTELFGPQLLKDTYIVQEFEYKDGQVAIPQGPGLGVDVDMDKVNFYTRK 373 Corynebacterium glutamicum ATCC 13032
BAB21460 324 GTELFGPLLLKDDIVTARPQYRDFDLHLPAGPGLGLQIDEDKLAFYRRD 372 Burkholderia sp. NK8
O33949   327 GTELFGPLLLTEEILTEPLRYENFVLHLPQGPGLGITLDWDKIDRLRRD 375 Acinetobacter lwoffii
CAG68309 322 GTELFGPLLLTQSILKTPLQYENFELVVPNTPGLGIEVDEDKLEQLRRH 370 Acinetobacter sp. ADP1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap