Conserved Protein Domain Family
type_II_gspE

?
TIGR02533: type_II_gspE 
type II secretion system protein E
This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131585
View PSSM: TIGR02533
Aligned: 9 rows
Threshold Bit Score: 755.755
Threshold Setting Gi: 13421293
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BMA2785  23 ARLLPYGFAKA-GQILIAHQHADTLEVWISERTSSAALAEVA-RNFG-AISLQRMPADELAQAINHAYARQDGSAAQIVG 99  Burkholderia ma...
P37093        14 IRRLPFSFANRfKLVLDWNEDFSQASIYYLAPLSMEALVETK-RVVKhAFQLIELSQAEFESKLTQVYQRDSSEARQLME 92  Vibrio cholerae...
AAK22161       3 TPMLAYGFAKRnGVVLLSLG--ERAVIGVREGYDPMALVEIR-RAVGaPLAIEPMTAPVFDRKFSEVYAGAGLATASSAD 79  Caulobacter cre...
CAE79474      77 IRDLPINYAKQ-HNVLPYKEDADLLIVLTSNPVNLKALDDMK-VLFGkRVRPLITTSSRVQDAINKVYEKSTANLSG-LD 153 Bdellovibrio ba...
AAR33661      26 LARLPLAFARG-RLVLPLRERDGRLLVVSGNPADLSAIDEVR-GVYGmEVELAAATPDTVLGAVNHLYARLGSSAQEVVE 103 Geobacter sulfu...
AAO28601      99 VHGLSIRFLKQ-FHVCPLAEHDGVLQLCVADPFDVYAIEALR-LATGaVLQLCIGLRSEIDDLVERWYGQGRSVMGMIVE 176 Xylella fastidi...
WP_002075227   5 FLQIPLKLIQK-SRIVPFSLSKKTIRIAVSDPSDLHPMDDARnFLKGyNVEFILAPEPEIMRIIHSHFDNTSSAAKEMLN 83  Leptospira inte...
WP_011552584 111 VKRIPINFAKQ-SRILPLSLEGDTVAVAVADPLDTAALDHVR-VLLGqSVSQRIALGSTITDAINSVYDRSVNETEQLVD 188 Myxococcus xanthus
WP_011061050   2 TTQLPYAWAKS-QRILLRHTEQG-AVLLVCPSTPGWSISEAR-RQFG-PARLERIRDEELDGLLATAYADTGSAAAVVG- 76  Pseudomonas pro...
tigr:BMA2785 100 EVEGEV-D-LSRLMQDIPEvEDLLEsEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFRVDGTLRDVVRPKKAL 177 Burkholderia ma...
P37093        93 DIGADS-DdFFSLAEELPQnEDLLEsEDDAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKL 171 Vibrio cholerae...
AAK22161      80 SLDLEG-G-LGLLLEDMPAaADLLDpQDDAPVIRLINGLIAEAVRLGASDIHIEPFEKALIVRLRIDGVLTEVLSLSPRI 157 Caulobacter cre...
CAE79474     154 EIAEED-Yd-----LDDPIvDLLEAgEDDAPVIKMVNSLLFRAVKEKASDIHIEPYEKDMAVRFRTDGILFDVFKPPKKL 227 Bdellovibrio ba...
AAR33661     104 ELEGED-LsVIATELAEPK-DLLDL-TDEAPVIRLLNSILSEAVKERASDIHIEPYERELEVRFRIDGILYRKLAPPKVV 180 Geobacter sulfu...
AAO28601     177 ATDGDA-A-------PTDDiEALRDlASEAPVIRLVNLVIQRAVELRASDIHIEPFENRLKVRYRVDGVLIDAESPPSKL 248 Xylella fastidi...
WP_002075227  84 EMEG------SFSELAEAFeNETLDlSDDAPIIKMVNVILSQAVNERASDIHIEPYEKSLVVRYRVDGILHNVLSPPKSY 157 Leptospira inte...
WP_011552584 189 EMETQDlD-AIAHELDEPK--DLLDeDDEAPVIRLVNSVLFRAAKERASDIHIEPMERELLVRFRVDGVLQEVIKPPKRY 265 Myxococcus xanthus
WP_011061050  77 AAENEV-D-LDRLMQDMPEiTDLLDtQDGAPVIRMINALLTQAARDEASDIHIEPFETHSVVRYRVDGTLRDVVSPRKAL 154 Pseudomonas pro...
tigr:BMA2785 178 HGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPTGHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDK 257 Burkholderia ma...
P37093       172 SSLLVSRVKVMAKLDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRR 251 Vibrio cholerae...
AAK22161     158 AAMLVSRVKVMAKLDIAEKRVPQDGRISLALGGKSLDVRVSTLPARMGERVVMRILDKDQAGLRLSDLGMSPDVLSALET 237 Caulobacter cre...
CAE79474     228 QNAITSRIKVMANLNIAEKRLPQDGRIPLKVGGKDIDIRLSCVPTTFGERLVMRIQDRSSVVRELAALGFSQDNLSRMEE 307 Bdellovibrio ba...
AAR33661     181 QEALVSRVKIMAGLNIAEKRLPQDGRIRVIVAGRDVDIRVSIIPTFFGERVVLRLLDKQKGLISLENIGLSEGGVRSMER 260 Geobacter sulfu...
AAO28601     249 AAAVVSRVKIMAKLNIAERRLPQDGRIMLRVQGKELDLRVSVVPTSHGESVVMRLLDRETVVFDFQKLGFTDELLNRFSR 328 Xylella fastidi...
WP_002075227 158 HAGISSRIKIMSNLNIAENRLPQDGRIKLRLAGKDIDIRVSTIPCQFGERIVMRLLNKTDQKYSLDTMGFYPELIQSLRS 237 Leptospira inte...
WP_011552584 266 QNAIVSRVKVMGQLNIAEKRLPQDGRIRIKLAGRDIDIRLSTIPTSFGERIVMRLLDKTATLLDLAEIGMSQKTLESMEA 345 Myxococcus xanthus
WP_011061050 155 HGALVSRIKIMAQLDIAEKRLPQDGRIALRVAGRPIDIRVSTVPTGHGERVVMRLLDKQAGRLQLETLGMDPELLARLDT 234 Pseudomonas pro...
tigr:BMA2785 258 -LISRPHGIVLVTGPTGSGKTTTLYASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDII 336 Burkholderia ma...
P37093       252 -LIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVV 330 Vibrio cholerae...
AAK22161     238 -AVREPHGIILVTGPTGSGKTTTLYAALAVLNDNSRNILTIEDPVEYAVHGIGQTQVNTKVGMTFAAGLRAILRQDPDVV 316 Caulobacter cre...
CAE79474     308 dILTRSYGIFLVTGPTGSGKSTTLYGALSKLNQPDVNILTVEDPVEQRIHGIGQVQVNSKIGLTFAAGLRSFLRQDPDII 387 Bdellovibrio ba...
AAR33661     261 -LLGRTSGIILVTGPTGSGKSTTLYAALNRLNSPEKNIITIEDPIEYQVKGIGQIQVNPKIELTFAQGLRAILRQDPDIV 339 Geobacter sulfu...
AAO28601     329 -VLEMPHGILLVTGPTGSGKTTTLYTVLNRLNTTGVKIITVEDPVEYQIEGINQIQAKPQIGLDFASALRSIVRQDPDII 407 Xylella fastidi...
WP_002075227 238 -LIYEPHGIILVTGPTGSGKSTTLYSALSELNTEERNIITCEDPVEYQIEGISQMQMQEKIGLTFATGLRAILRQDPDVI 316 Leptospira inte...
WP_011552584 346 -VIKRSHGIILVTGPTGSGKTTTLYGALSKINTPDLNILTVEDPVEYQLKGIGQMAISPKIGLTFAQGLRSFLRQDPDVI 424 Myxococcus xanthus
WP_011061050 235 -LIRQPHGIVLVTGPTGSGKTTSLYAALARLDASTSNILTVEDPVEYDLPGISQIQVNAKIDMTFALALRAILRQDPDII 313 Pseudomonas pro...
tigr:BMA2785 337 MIGEIRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRLVRQLCPACKEERHEGGRA 416 Burkholderia ma...
P37093       331 MVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQ 410 Vibrio cholerae...
AAK22161     317 MVGEIRDSETAQIAVQASLTGHLVLSTVHTNDAAGAVVRLRDMGVEPFLLASTLRLVIAQRLVRRLCEHCRTPEPADAAT 396 Caulobacter cre...
CAE79474     388 MVGEIRDLETAELAIQASLTGHLVLSTLHTNDSAGAFPRLIDFGVEPFLIATSITGVIAQRLVRVLCPHCKAPHEATDFE 467 Bdellovibrio ba...
AAR33661     340 MVGEIRDAETAEIAMQASLTGHLVLSTLHTNDSATAIARLVDMGIEPFMVASSLSAVLAQRLVRRICPHCRESYTP---E 416 Geobacter sulfu...
AAO28601     408 MIGEMRDLETARIAIQSALTGHLVLSTLHTNSAAGGLTRLLDMGVEDYLLTSTINGVLAQRLVRRLEPMHAERYLASPEQ 487 Xylella fastidi...
WP_002075227 317 MVGEIRDEETARIAIQASLTGHLVFSTLHTNDAASAATRLIDMGIEPYLITSTVLGFMAQRLVRVICTQCKETYKPTTSE 396 Leptospira inte...
WP_011552584 425 MVGEIRDKETAEIAIQASLTGHLVLSTVHTNDAAGAVTRLVDMGVEPFLVASSLTGILAQRLVRRVCPDCRVPFEPTDAE 504 Myxococcus xanthus
WP_011061050 314 MIGEIRDLETAQIAVQASLTGHLVLATLHTNDAVSAVNRLIDMGVEPFLLASSMLGVLAQRLVRRLCSQCKEQDPANPGT 393 Pseudomonas pro...
tigr:BMA2785 417 -------------------VWHPVGCDKCGHSGYTGRRGVYELLVIDDSIRSLIHRNAADAEILATGRAnGMRTLRDDAE 477 Burkholderia ma...
P37093       411 rklfdsk------kkepliLYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRA-TTPSIRDDGL 483 Vibrio cholerae...
AAK22161     397 aalvgl--------pegeiLYRPVGCAHCGHTGYQGRIGVYEALRVDDHLRRLIGGNASEQEITEAG---LDRRLGQEAR 465 Caulobacter cre...
CAE79474     468 iqllgitr----eeankanICKAMGCNHCSQKGYSGRTNIGELLIVTDDIRSLIMQRKDGNTIKRQAVAnGMKTFRDHGI 543 Bdellovibrio ba...
AAR33661     417 rdyagi--------tlpstLYRGRGCDACFGLGTLGRVGIYELLPVDGEICSMIIRREPAGAIKEYAVGkGMRTLRDDGL 488 Geobacter sulfu...
AAO28601     488 iarfdlrr---lqpegdiyLYRPR-ASALAPTGYLGRTAIVEFLIMDDALRRAVISRTGIGELEQIARQaGMRTMYEDGL 563 Xylella fastidi...
WP_002075227 397 lesigisk----kflkngnLHRGKGCSHCMGTGFKGRIGIYELLLVNSPLKQAILHGKDAGQLNEIALEhGFRTLKDYGI 472 Leptospira inte...
WP_011552584 505 lkelghsvasfkqrygvdrIYKASGCPSCNRNGYRGRTGIYEFLPVDDDVRQLVLKNVDASTIKRSATSkGMTTLLDDGA 584 Myxococcus xanthus
WP_011061050 394 --------------------WRPVGCPACNHIGYSGRTGIHELFCIDDDVRSLIHQGAEEQALRAAARRaGMFSMREDGE 453 Pseudomonas pro...
tigr:BMA2785 478 RWLAAGATSLEEVLRVT 494 Burkholderia mallei ATCC 23344
P37093       484 DKVRQGITSLEEVMRVT 500 Vibrio cholerae O1 biovar El Tor str. N16961
AAK22161     466 NYVLAGLTTVEEALRIT 482 Caulobacter crescentus CB15
CAE79474     544 QKVLAGITTIEELTSNT 560 Bdellovibrio bacteriovorus HD100
AAR33661     489 AKAAAGITTIEEVLRVT 505 Geobacter sulfurreducens PCA
AAO28601     564 IKALAGETTIEEVLRVT 580 Xylella fastidiosa Temecula1
WP_002075227 473 RKVVDGVTTIDEVLRVT 489 Leptospira interrogans
WP_011552584 585 RKIALGETTIAEVLSIT 601 Myxococcus xanthus
WP_011061050 454 RWVRSGATAPEEILRVT 470 Pseudomonas protegens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap