Conserved Protein Domain Family
EutP

?
TIGR02528: EutP 
ethanolamine utilization protein, EutP
This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 131580
View PSSM: TIGR02528
Aligned: 5 rows
Threshold Bit Score: 214.231
Threshold Setting Gi: 19713501
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P76556         2 KRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDkGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRL 81  Escherichia col...
BAB80600       2 GRVIFMGKTGCGKTTLCQALNNLEIKYKKTQAIELYD-NAIDTPGEYMENRGYYTALIVTAADADIIALVYDCTSEENYI 80  Clostridium per...
AAL94288       2 KKIMLIGRTSCGKTTLTQKLMNEEVKYKKTQAVTYKS-KIIDTPGEYVENKMYYKSLLVLSADAKIIVLVQSAIDGATLF 80  Fusobacterium n...
Q9XDM6         2 KRLMFIGPSQCGKTSLTQSLRGEALHYKKTQAIEWSP-MAIDTPGEYLENRCLYSALLTSACEADVIALVLNADAQWSPF 80  Salmonella ente...
WP_003721544   2 KKMMVMGSVGCGKTTLCQKLHGYDILYKKTQAVEYFQ-EMIDTPGEFVQHRQLYSALTVTAADASVIAILQSVTEKKQTF 80  Listeria
P76556        82 PAGLLDIGVSkRQIAVISKTDMPDADVAATR-KLLLETGFEEPMFELNSHDPQSVQQLVDYLAS 144 Escherichia coli K-12
BAB80600      81 APGFASMFCK-EVIGIITKINLAKDKSEIEVaEERLNLAGVSKIFKVDTVDDVGIKELFNYLNK 143 Clostridium perfringens str. 13
AAL94288      81 PPKFSTMFPKkEVIGLVTKIDLA--DADIERsKRFLVEAGATEVFTIGLNDEKGLEAIKKRLVM 142 Fusobacterium nucleatum subsp. ...
Q9XDM6        81 SPGFTAPMNR-PTIGLVTKADLAE-PQRISLvAEWLTQAGAQQIFITSALNNSGLDAVLDFLNS 142 Salmonella enterica subsp. ente...
WP_003721544  81 SPMFASIFAK-PVIGIVTKVDLAESDKDIERaERELRMAGAKHIFYISSVEETGIEELRAYLED 143 Listeria
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap