Conserved Protein Domain Family
eut_PduT

?
TIGR02526: eut_PduT 
PduT-like ethanolamine utilization protein
This gene shows up in ethanolamine utilization operons in which a proteinaceous coat organelle is also encoded. It is closely related to the PduT protein in propane-diol operons with the same structure.
Statistics
?
PSSM-Id: 131578
View PSSM: TIGR02526
Aligned: 3 rows
Threshold Bit Score: 254.804
Threshold Setting Gi: 28204218
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB80614       1 MKKSIGALEFRSISKGIEVSNEVVKKAFVEVSYLKSICPGKFFLIVNGDAGEVKEAIEFGEKLGEKYLVGSFIINSIHHD 80  Clostridium per...
AAO36657       6 MKKALGLLEFNSISKGIETSDVLLKAAFVEVEILRQICPGKFLTIISGDVEEVKEAIDKAKSKDNKKLVESNIITSVHED 85  Clostridium tet...
WP_003721583   2 AEQSLGILELRSISKGYEMADVFLKAGNVTLFTFRPTCPGKFLIILQGASGELTSAMQDAKEEAGKFHVSSYILHMAHEE 81  Listeria monocy...
BAB80614      81 IINALKGKYSQKniEDKAIGIMETGKVSSGILALDKTLKSSEVNLVKLQLAFGIGGKLVYIVSGDLSSVENGMREGQSIL 160 Clostridium per...
AAO36657      86 ILKALKKRPIIK--EFNAIGVMEFSTVTSSLVALDIALKTSDIQLVKLVLGNGIAGKAYFIINGSVSSVEEGVKSAQNCV 163 Clostridium tet...
WP_003721583  82 LLAFLNNK--HPkvEVDAVGIIEISQLGAGLNAVNEALKKSAIHLKRMTLGASIGGKFVAVFTGEVSAIQEGMRILIETA 159 Listeria monocy...
BAB80614     161 QEKDIINVSIIPFVHSEIAKNL 182 Clostridium perfringens str. 13
AAO36657     164 NSKRIVHSTVIPSPSKILLQNI 185 Clostridium tetani E88
WP_003721583 160 EPKKVIHHTVIPSPDELLKRYL 181 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap