Conserved Protein Domain Family
plasmid_TraJ

?
TIGR02525: plasmid_TraJ 
plasmid transfer ATPase TraJ
Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524). [Mobile and extrachromosomal element functions, Plasmid functions]
Statistics
?
PSSM-Id: 131577
View PSSM: TIGR02525
Aligned: 4 rows
Threshold Bit Score: 654.566
Threshold Setting Gi: 28856085
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN87678   4 FNFGPtLTPQTLERFLVHCSNNEVSDILLQGGDKIWVERHGRQLPMTSYPLDNLELERTVDKVFGQEIKGTLKSAAVVNT 83  Citrobacter freundii
AAQ17616  10 FPFSR-FTAEEFRHFFAWCARHRVSDIDLTGGSPVSVSRFGRRVRSSVNPLPSSIMMALSDELFGREVLPRVLSGHPVDR 88  Escherichia coli
AAO59141  13 YAFEDgLNADTLRDFFVWCERQSASDIHIQGGNHLVVGHQGRLRQASRFVLADDTWSKLLDDLFSPEIRPTVRGGRPVDR 92  Pseudomonas syringa...
AAR13113   7 FDFRGgITADKLREFFVHCYRHNVSDIHLQSGSPIVVDHHGRKVVASQFPLEHANLVRLIDEVYTPDIKSLVQGGQGADR 86  Serratia entomophila
AAN87678  84 AIQLRGDEAGTIGLGRGETRRFRANFTQADIYKTEAAMSLTLRVLNEVIPQLKQMGIEPDLFNSLLPAAGLGLICGETGS 163 Citrobacter freundii
AAQ17616  89 TIQVSGDASGRYGLQRGQRVRLRCHLIQGTSATEEKAISVTMRVIPSDIPDILTMNIEPDLLDAMLRKTGLGFICGETGS 168 Escherichia coli
AAO59141  93 AIQLDGDINQRYGLERGERLRFRCNFVQATAGRLDTTIALTMRIIPSDIPDLTKMGLEEDLFEALLPSNGLGLIGGITGS 172 Pseudomonas syringa...
AAR13113  87 PLQLEGDNNGRFGLKRGERVRFRTNFIQATIGALNTAIAMTLRIIPSNIPILEEMGIEKDLYRSFLPMDGMGLVCGPTGS 166 Serratia entomophila
AAN87678 164 GKSTLMASIFQYCGETYQDRKIITVEDPIEYRLGSRDWIAPaPAQSQIGRDIDSFHNFITLSgLRRSPKIMGVGELLNRL 243 Citrobacter freundii
AAQ17616 169 GKSTLAAALYRHILKNFPDRKIVTYEDPVEYILGGENDLLP-PHQAEIGRDVESFAAGLRSA-VRRNPDIIGIGEIRDYE 246 Escherichia coli
AAO59141 173 GKSTQAAAIYRFCLDTDPDRKVTTIEDPIEFILARPGDVLA-STQLQIGRDVANYAEGIRAD-LRRAPSIIGVGEMRDLE 250 Pseudomonas syringa...
AAR13113 167 GKSTLLASVYQHYGETNPNGKLVTYEDPVEYLLNSPRLLLR-PQQSEIGRDVPSFAHGLRLA-LRRAPHIIGIGEIRDLE 244 Serratia entomophila
AAN87678 244 SFEAAVLAGKSGHFCLGTLHVKTVGEAISRSLQNYPPEMREAAAFDLLSILSYIIVQRLLKTKDGRRKAVREYLVIDNSL 323 Citrobacter freundii
AAQ17616 247 TADAAVQAGNTGHFCIGTMHTKSPGETFARLLGLFPPEIRDSMAAATLSLVQFILVQVLVRTNDGGRQAVREYIVMTDEL 326 Escherichia coli
AAO59141 251 TFQAAVLAGQVGHFNLSTLHIHSPGEAIPRCLTMVPSEMREATAHDLLSVLQYIIVQKLLRTTDGKRQAVREYIIFDDGL 330 Pseudomonas syringa...
AAR13113 245 TLQAAVACAQSGHLTLGTLHAFSPGHAFSRCVLMAPNDSREQIAFDLLDAMRFVVVQHLLPTTDGKRQAVREYVLFDDDW 324 Serratia entomophila
AAN87678 324 RRKLYDVDYSKWGRYIDDLLIAENRSLIQNAWAMHQEGLIDEAEVIEVAGYMDY 377 Citrobacter freundii
AAQ17616 327 RNTLSGQSHATWGHYIDEIIRQEKRRIRDQVLTMYQNDRIEKSEAALFIPAGEF 380 Escherichia coli
AAO59141 331 RAKLASMPYPEWGRHIDSIIRLEQRRFADQAWRLHLEGRIDRRELAVAMTASQL 384 Pseudomonas syringae pv. tomato str. DC3000
AAR13113 325 RHRLGLEHYSRWPEMINATLREKQSRIADQAWALFVEGRIDNRVAERVIGWREF 378 Serratia entomophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap