Conserved Protein Domain Family

TIGR02524: dot_icm_DotB 
Dot/Icm secretion system ATPase DotB
Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
PSSM-Id: 131576
Aligned: 2 rows
Threshold Bit Score: 705.616
Threshold Setting Gi: 29542204
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAH13883            336 TRKLVRQKGQLMTWDAKMKFEQGIISERVYKLIIAGAK 373 Legionella pneumophila str. Paris
lhbprmlnih:CBU_1645 335 VRRLVAEHGQPMQVDVEAKFKGGLISERLYKILSASQE 372 Coxiella burnetii RSA 493
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap