Conserved Protein Domain Family
type_IV_pilW

?
TIGR02521: type_IV_pilW 
type IV pilus biogenesis/stability protein PilW
Members of this family are designated PilF and PilW. This outer membrane protein is required both for pilus stability and for pilus function such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain.
Statistics
?
PSSM-Id: 131573
View PSSM: TIGR02521
Aligned: 12 rows
Threshold Bit Score: 195.634
Threshold Setting Gi: 33147773
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD14915         8 VSLVFTLAAAGCALPPppaqtqDVKTLSDQTDISRrAAIRLQLATQYLEAGQAATALDEVKNAIAIDPSVPGAYHIRALA 87  Ralstonia sol...
CAD84057         8 GVLGFLVWLAGCGHAPvq--ekPTPEELKQRALQS-AKIHTELAGQYYHRGQYRVAIEEAEIALQKKTDYAPAYNMLGLV 84  Nitrosomonas ...
tigr:MCA2888     6 ALTALLGAIAACATPEq-----RPYATNDPYGELStADVYVQKGVRYMAQGALEVALEDLKHAVELDPANSDAHDALAIL 80  Methylococcus...
AAO54953         7 LLLCAVVLLTGCVSTG------NVNPMTTTQGREEaRRAYVQLGLGYFEQGQTERAKVPLKKALELDSSDAQANAALALV 80  Pseudomonas s...
CAG67483        13 AAIVGAFILSGCQTV------------PTTKDPEKgVKVRTQLAAEYIKSGDLDSAKRALDQALKVNPKDSSANMMMGVL 80  Acinetobacter...
P43988           9 SAVIFPFIFSACVSQS-----------ASSLNHQTaAKARVELALSYLQQNNPQLAKINLDKALQHDKNYYLVHSALAHY 77  Haemophilus i...
AAP95295         9 TACFAIVMLLGCSSSY-------TGSSVSTFNRNKiVQARINLALAYLEQHHFAKAKENIDKALQHDAQDYLPYSALAYY 81  Haemophilus d...
CMCP6:VV1_2773   9 PQLVALTLLTGCVTVT------E-GQAQKDPDPIGmAESRIALGLGYLENGAMIKAHDNLQQALTHAPDYYRAQLSMAHY 81  Vibrio vulnif...
CAH22081         9 VCLVVS-VLTGCSGT-----------PPENTSQAVaGQTRLQLGLAYLAQGDLTAARKNLEKAVEADPQDYRTQLGMAFY 76  Yersinia pseu...
AAN56312        10 LAIALSLTVTGCVTERtyt-gtDIPVSERKLDRVAaARERMQLGLTYLNRGNSEQAKYNLDKAIEYAPELEDVHVAMAYY 88  Shewanella on...
cucgc:lpg1546    9 LTIIICLFVGACQHTQd----nEEPNSIRKVNLSKaASFNVQLGLGYLKQGDRPRAKKKLLTALEQQPDSADVNAALAYY 84  Legionella pn...
WP_011798919    21 ISLLLVLALGACSTSY---------RPSRAEKANQvSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEI 91  Neisseria men...
CAD14915        88 YMSLG---QHELADDSFRRALSMQPNDGDLLNNYGWFLCAQGg-KPDQGMAMLRQAIEAPA-VGSPSKPWTNLGVCQMRQ 162 Ralstonia sol...
CAD84057        85 YMDLQ---EDDRAEWNFERGLGITPNDPDIRNNFGWFLCQRKpdGIEQAIGHFMAAVRDPL-YETPERTYTNAGLCVLKQ 160 Nitrosomonas ...
tigr:MCA2888    81 YEKLG---RTGEADLHFREALTLNPENYSAYNNYGRFLCHTG--HTEEALARFEVAYSTPL-YPQPWIPLSNAGTCLRRA 154 Methylococcus...
AAO54953        81 FQTEM---EPQLAEQYFRKALASSNNETRIVNNYGSFLFEQK--RYQEAYERFEQAAADNL-YPERSRVFESLGMTSLKL 154 Pseudomonas s...
CAG67483        81 LQQEGsrpNLEKADAYFERAVQLDPENAQAHNNYGTYLYQMK--RYHDAIQQLTLAGSSLG-YDQRYRALENIGRIYLHL 157 Acinetobacter...
P43988          78 YQQQG---QIENAFREYEIAVNLNHKQGDVHNNFGTFLCSQK--KFEQAQQQFELALNSPN-YYHQADTFENIVLCAYSA 151 Haemophilus i...
AAP95295        82 YQQIG---DLTQAANAYQTALTLGNNTPDVLNNYGTFLCHQG--KFDLAYQQFEQAIKSQQsYYHQADSLENIILCAKQE 156 Haemophilus d...
CMCP6:VV1_2773  82 YERVG---ENGKAEDIYQKSARQHPKNGNVLNNYGTFLCKKG--EYDKADRLFNRAIEQPY-YYLIPASYENAAFCALKA 155 Vibrio vulnif...
CAH22081        77 AQRIG---ENSAAEQRYQQAMKLAPGNGTVLNNYGAFLCSLG--QYVSAQQQFSAAALLPD-YGQVADSLENAGYCFLRA 150 Yersinia pseu...
AAN56312        89 YQTVG---DLVRTERAYQDAINTKDASGDSMNNFGVFLCQQK--QYDKAEKMFLAAIEMPK-YTRTASSYENLGLCSRDA 162 Shewanella on...
cucgc:lpg1546   85 FEQTK---ELEQAKKFYHKAITLSQNGGAQLNNYGAFLCRQG--DYKNAETYFLKAVKDQN-YVHTSGAYENAGLCAMAI 158 Legionella pn...
WP_011798919    92 YQYLK---VNDKAQESFRQALSIKPDSAEINNNYGWFLCGRLnrPAES-MAYFDKALADPT-YPTPYIANLNKGICSAKQ 166 Neisseria men...
CAD14915       163 GDLDGAEKSLTRATYIDANNPLTNLTLAQLHYKRRDYARAMSFIERVNGR---GNPTAESLWLGARIARRLGDVSQQNAW 239 Ralstonia sol...
CAD84057       161 NDFERAQSYFQEALVIRPGYPLARLGLVELDFSRGEVKKAWAAINRYLQT---YPPAPGSLWLAVRIARANGDVNAETNY 237 Nitrosomonas ...
tigr:MCA2888   155 GRTAEAEPYLRRALEKNPGYPPALLEMAHVSLETRQYLSTRAFLQRYQAVa---gDTPETLWLGVQTELALGDAAEARRL 231 Methylococcus...
AAO54953       155 GNREQAREQFTKALRLDRQQPRSLLEMAQLYYEDRQYVPARDYYDRFSQLs---EQNARSLLLGTRLAKVYDDRNKAASY 231 Pseudomonas s...
CAG67483       158 GGVANAEKMFSQALQANRDSSVSMLELAEIYYLQQRIPAATGMYEQYVRTvgqKNQGARALWIGIRVARANADRTGVQVL 237 Acinetobacter...
P43988         152 QKMDIYQQTLEKLRQIDGKRAEKFNSLK---------------------------------------------------- 179 Haemophilus i...
AAP95295       157 KNTAKIAIALQQLTALDKTRADALR------------------------------------------------------- 181 Haemophilus d...
CMCP6:VV1_2773 156 GDNVKAQTYFTRAIDYDPHRPKSVLNLAKLEIDTGNYTQARLRLMRFHQSy---GLQIPSLKLMIDLEDKAGNVALVKKY 232 Vibrio vulnif...
CAH22081       151 NQDKQARVLLSRALKYDPDKGEPLLAEAQRYFGEGNRAQAQLLLDVYQHTl---PASAESLWLQIRFAALAGRQDSVQRY 227 Yersinia pseu...
AAN56312       163 GRAEKARQYFQMALKYDPRRSVSLLELVELGMNKGDYIDARNQLARYHQVa---AQTPESLTLGIKIEQALNDDAAMKRF 239 Shewanella on...
cucgc:lpg1546  159 PDHDKAILYFTKALNQDPSRKESLYELVKLQSKIGHDKEALELLQKHADLv---LNDKVMLALAKDIANRTGQYTLAAEY 235 Legionella pn...
WP_011798919   167 GQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRv--EVLQADDLLLGWKIAKALGNAQAAYEY 244 Neisseria men...
CAD14915       240 SAQLQRRFP 248 Ralstonia solanacearum GMI1000
CAD84057       238 AFQLQKRFP 246 Nitrosomonas europaea ATCC 19718
tigr:MCA2888   232 ADRIGVDFP 240 Methylococcus capsulatus str. Bath
AAO54953       232 GLQLKRLYP 240 Pseudomonas syringae pv. tomato str. DC3000
CAG67483       238 VNQLRIFYP 246 Acinetobacter sp. ADP1
P43988             ---------     Haemophilus influenzae Rd KW20
AAP95295           ---------     Haemophilus ducreyi 35000HP
CMCP6:VV1_2773 233 QSELDKLTA 241 Vibrio vulnificus CMCP6
CAH22081       228 GKQLARSFP 236 Yersinia pseudotuberculosis IP 32953
AAN56312       240 GILLLAKFP 248 Shewanella oneidensis MR-1
cucgc:lpg1546  236 ENSFNKLEQ 244 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
WP_011798919   245 EAQLQANFP 253 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap