Conserved Protein Domain Family
EutH_ACDH

?
TIGR02518: EutH_ACDH 
acetaldehyde dehydrogenase (acetylating)
Statistics
?
PSSM-Id: 131570
View PSSM: TIGR02518
Aligned: 4 rows
Threshold Bit Score: 832.202
Threshold Setting Gi: 28203558
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB80608       5 DKDLVSIQETRGLIRKAKEAQSKLARMSQQDIDRIVKAISDAAYENSEKLAKMANEETGFGKWEDKVLKNVFAARTVYES 84  Clostridium per...
AAL94297       2 DRDLLSIQQVRDLIKSAKVAQKLYSTFTQEQIDKVVCAIVEEMKNHYVDLAKKANEETGFGKCEDKVIKNKFANEFVYDC 81  Fusobacterium n...
AAO35999       5 DKDLYSIQQARNLARLGKVAANKIANYTEEQIDKILRNMVRVAEENAVSLAQMAVEETGFGKVEDKTYKNHLAATILYDS 84  Clostridium tet...
WP_003761793   5 DKDLRSIQEVRNLIESANKAQKELAAMSQQQIDTIVKAIADAGYDAREKLAKMAHEETGFGIWQDKVIKNVFASKHVYNY 84  Listeria innocua
BAB80608      85 IKDTKTVGIVEENveKRAFKIMVPVGVVAGLIPSTNPTSTAIYKAMISIKARNAIVLSPHPSAKKCIIETAKIIAKAAER 164 Clostridium per...
AAL94297      82 IKDMKTVGILNET--DTVTEVGVPMGIVAALTPSTNPTSTAIYKTLISLKAGNAIIVSPHPNAKNCVIDTVKLMQKAAYA 159 Fusobacterium n...
AAO35999      85 IKDMKTIGVISEDkvNKMIEIAEPVGLIMGIVPSTNPTSTAIFKSIIAIKSRNAIVFSPHPAAAKCTIRAVELMRDAAIE 164 Clostridium tet...
WP_003761793  85 IKDMKTIGMLKEDneKKVMEVAVPLGVVAGLIPSTNPTSTVIYKTLISIKAGNSIVFSPHPNALKAILETVRIISEAAEK 164 Listeria innocua
BAB80608     165 AGCPEGAIGCITVPSIEGTNELMKNKDTSLILATGGEAMVRAAYSSGTPAIGVGPGNGPAFIDKSADVKLAVKRILDSKT 244 Clostridium per...
AAL94297     160 AGAPVGLIGVIEIPTIEGTNELMKSKDTSIILATGGEAMVRAAYSSGRPAIGVGPGNGPAYIEKTANIKEAVRKIIESKT 239 Fusobacterium n...
AAO35999     165 AGAPEDIIASLTNLTMEATNELMKNENVSLIIATGGPGMVKAAYSSGKPAIGVGAGNSPAYIERTANVEKAIRDIISSKS 244 Clostridium tet...
WP_003761793 165 AGCPKGAISCMTVPTIQGTDQLMKHKDTAVILATGGSAMVKAAYSSGTPAIGVGPGNGPAFIERSANIPRAVKHILDSKT 244 Listeria innocua
BAB80608     245 FDNGTICASEQSIVVEKAMEDEVVRELKEQGAYFLTEEQANQLSKFVMRANGTMNPQIVGKTPQDIAKLAGLEgIPSWAR 324 Clostridium per...
AAL94297     240 FDNGVICASEQSVIVEPCNKEAVMDEFRRQGGFFLSKEESEKLGRFILRPNGTMNPQIVGKDAQTLAKLAGLN-IPLNVK 318 Fusobacterium n...
AAO35999     245 FDYGTICASEQSIICEECNHDAVVEELKKQGGYFMTAEETEKVCKLLFKNGHTMNAKFVGRSPQVIANAAGFT-VSEDIK 323 Clostridium tet...
WP_003761793 245 FDNGTICASEQSVVVERVNKEAVIAEFRKQGAHFLSDAEAVQLGKFILRPNGSMNPAIVGKSVQHIANLAGLT-VPADAR 323 Listeria innocua
BAB80608     325 VLVPRECHVGHKYPFSREKLTTILTFFVEENVDAVLNRCREILLNEGAGHTFCMHANNEELVKRFALEMPVSRMVVNSPG 404 Clostridium per...
AAL94297     319 VLLSEQNTVSKTNPYSREKLTTILAFYVEENAEKACERAIELLENEGEGHTLIIHSEDKDIIREFALRKPVSRMLINVGG 398 Fusobacterium n...
AAO35999     324 VLIGKQNGVGNGNPLSFEKLTTVLAFYTVKDWHEACELSIELLQN-GIGHTMSIHTQNDDIVMEFA-KKPASRILVNTGG 401 Clostridium tet...
WP_003761793 324 VLIAEETKVGAKIPYSREKLAPILAFYTAETWQEACELSMDILYHEGAGHTLIIHSEDKEIIREFALKKPVSRLLVNTPG 403 Listeria innocua
BAB80608     405 ALGGIGATINLVPALTLGCGAVGGSSTSHNIGPLDLMNTRNVAYGIRELEDIR-ELAVgatkevSASLDLG--------- 474 Clostridium per...
AAL94297     399 SLGGVGATTNLAPAFTLGCGAVGGSSTSDNITPMNLINIRRVAVGVRELSDFKkDTNT------SSNLDVI--------- 463 Fusobacterium n...
AAO35999     402 SQGGTGASTGLKPAFTLGCGTWGGSSVSENVTPEHLINKKRVAYGLKDCATLVqNDPTfnciktASNCRGVknqfmnmsp 481 Clostridium tet...
WP_003761793 404 ALGGIGATTNLVPALTLGCGAVGGSSSSDNIGPENLFNIRRIATGVLELEDIRkEENQ------ATPELSV--------- 468 Listeria innocua
BAB80608     475 ------------------------------DKEelINLLVKKIIEELK 492 Clostridium perfringens str. 13
AAL94297     464 ------------------------------NSE--VEDMIRRIIAEYR 479 Fusobacterium nucleatum subsp. nucleatum ATCC 2...
AAO35999     482 aqiaaaaevlnkcndyakntgcsneskekdANNeeLLSLVNQIVAAMK 529 Clostridium tetani E88
WP_003761793 469 ------------------------------DADalIQSLVEKVLAELK 486 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap