1XKP


Conserved Protein Domain Family
type_III_yscB

?
TIGR02513: type_III_yscB 
Click on image for an interactive view with Cn3D
type III secretion system chaperone, YscB family
Members of this family include YscB of Yersinia and functionally equivalent (but differently named) proteins from type III secretion systems of other pathogens that affect animal cells. YscB acts, along with SycN (TIGR02503), as a chaperone for YopN, a key part of a complex that regulates type III secretion so it responds to contact with the eukaryotic target cell.
Statistics
?
PSSM-Id: 131565
View PSSM: TIGR02513
Aligned: 5 rows
Threshold Bit Score: 183.092
Threshold Setting Gi: 62738461
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XKP_C     2 QNLLXNLAASLGRXPFVADXQGVYRLTIDXHLVMLAPHGSELVLRTPIDAPMLREGNNVnVTLLRSLMQQALAWAKRYPQ 81  Yersinia pestis
AAC44773   2 DHLLSGLATRLGQGPFVADRTGSYHLRIDGQSVLLLRQGDDLLLESPLEHAPLDPQRDQ-LGLLRALLSRVASWSRRYPQ 80  Pseudomonas aeruginosa
Q56973     2 QNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVLRTPIDAPMLREGNNVnVTLLRSLMQQALAWAKRYPQ 81  Yersinia pestis
AAO18034   2 QTLLNHLASRLGQKPFVSDRQGHYHLHIDNYNLFLRQQGTELVLSSPLSWR-HNPKDPSgAELLKTLLQQVTRWGRHAPH 80  Photorhabdus lumine...
BAC59960   3 DKMMKSLAETLGIGPFIAGENGAYTIEVDQLTLTIKQHSSWILWETALPLRFNEHLDYQqEQALKRCMQLSLKTLRDTPS 82  Vibrio parahaemolyt...
1XKP_C    82 TLVLDDCGQLVLEARLRLQELDTHGLQEVINXQLALLEHLIPQLTPFSV---ASRVGWN 137 Yersinia pestis
AAC44773  81 AIVLDADGRLLLQARLGLDGLDPERLERALAAQVGLLEALAPELEPLPRglpPQAPVWR 139 Pseudomonas aeruginosa
Q56973    82 TLVLDDCGQLVLEARLRLQELDTHGLQEVINKQLALLEHLIPQLTPFSv---ASRVGWN 137 Yersinia pestis
AAO18034  81 ALTLDESENLILEARLDLDSLDAQILEQMLTMHVDLLEQVMALLSETQSspqWKQVIWQ 139 Photorhabdus luminescens
BAC59960  83 VLTTNADQQLILQGKAMIENTSNDQFAELLAQHANVCERYMEMLEHERVnhtISHHVWL 141 Vibrio parahaemolyticus RIMD 2210633
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap