2P58


Conserved Protein Domain Family
type_III_yscG

?
TIGR02508: type_III_yscG 
Click on image for an interactive view with Cn3D
type III secretion protein, YscG family
YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion). The secretion system delivers effector proteins, designate Yops (Yersinia outer proteins) in Yersinia. This family consists of YscG of Yersinia, and functionally equivalent type III secretion machinery protein in other species: AscG in Aeromonas, LscG in Photorhabdus luminescens, etc. [Protein fate, Protein folding and stabilization, Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131560
View PSSM: TIGR02508
Aligned: 5 rows
Threshold Bit Score: 136.903
Threshold Setting Gi: 28806685
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P58_C     3 KYKLNVLLAEIALIGTGNHYHEEANCIAEWLHLKGE-EEAVQLIRLSSLXNRGDYASALQQGNKLA--YPDLEPWLALCE 79  Yersinia pestis
Q01248     2 KYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGE-EEAVQLIQLSSLMNRGDYASALQQGNKST--YPDLEPWLALCE 78  Yersinia enterocoli...
AAQ56239   2 NPELKRQLTELALAGTGHHCHQEAATIADWLAGAPEmTECVTLIRLSSLMNRGDYQAALQLGGEHC--TPDIEPWLALCE 79  Aeromonas veronii
BAC59956   2 ERELRQLLAEIALMATGMHRHQEANTIADCLEETSNsEEVVVMIRAMSLMNKGAYEEAHRLLEPLCtaYPDLISLAALAA 81  Vibrio parahaemolyt...
AAO18030   2 TRSLKGLLADIALVGSGHHCHDEANMIADWLMSSEEgQEAANLIRLSSLTNQGQYQQALDFGRDLP--WPSLEPWLALCE 79  Photorhabdus lumine...
2P58_C    80 YRLGLGSALESRLNRLARSQDPRIQTFVNGXREQLKT 116 Yersinia pestis
Q01248    79 YRLGLGNALESRLNRLATSQDPRIQTFVNGMKEQLKT 115 Yersinia enterocolitica
AAQ56239  80 WRLGQQEALVARLLRLEQSGQPALQQFAAGLREQMTS 116 Aeromonas veronii
BAC59956  82 AKAGLLS-QAERWMELAAQGSEESQAFAASFTQDIRN 117 Vibrio parahaemolyticus RIMD 2210633
AAO18030  80 WRLGLASALEQRLTRMAGSDDPQLLSFVDGMREQIAH 116 Photorhabdus luminescens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap