1XKP


Conserved Protein Domain Family
type_III_SycN

?
TIGR02503: type_III_SycN 
Click on image for an interactive view with Cn3D
type III secretion chaperone SycN
Members of this protein family are part of the machinery of bacterial type III secretion in a number of bacteria that target animal cells. In the well-studied system from Yersinia, a complex of this protein (SycN) and YscB (pfam07329) acts as a chaperone for the export of YopN (). YopN then acts to control effector protein secretion, in response to calcium levels, so that secretion occurs only after contact with the targeted eukaryotic cell. [Protein fate, Protein folding and stabilization, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131555
View PSSM: TIGR02503
Aligned: 7 rows
Threshold Bit Score: 116.028
Threshold Setting Gi: 33563632
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XKP_B         4 IEPIISHFCQDLGVPTSSPLSP-LIQLEMAQSGTLQLEQHGATLTLWLARSLAWHRCEDAMVXALTLTAAQXSGALPLRA 82  Yersinia pestis
Q52095         4 IEPIISHFCQDLGVPTSSPLSP-LIQLEMAQSGTLQLEQHGATLTLWLARSLAWHQCEDAMVKALTLTAAQKSGALPLRA 82  Yersinia entero...
AAS94480       2 LQDTIAAFARRMGMTGFVPSAGgLAAFDIDGVGRLYVEPSDDTLLVYLARAVPAHET-HLPRRLLDLSHYRHAWPLPLQG 80  Desulfovibrio v...
CAE42533       4 ADRALHQFGQDIGIEGLAFGPSgSASLALSNGRRLGVECVAGAALVHLAQRVERDAA-SVLLAAWKRAHGQRGSAASIQT 82  Bordetella pert...
AAQ60271       5 TARRLEQFLQLSELPTPRVEPR--MEFSMP-PFRLYIEYLDGRVLLSLARSIEHVHQSEALKRLLASCQPARTQGTPLRA 81  Chromobacterium...
WP_003113546   4 VELAVAQFCQDLRVSVPAPLAR-VVQLDFEDSGTLQLERHGEQLSLWLACDLAWHQAYRGTLRALRLCHARAAGSLPLRC 82  Pseudomonas
AAS13315       4 IDASVDDFCRGMGLEAVDFSSAgRVQLSFEQSGTLHIEKHQDCLFLMLAKPLPWHQSNELIKKALSFCHAGQGWPFLIKT 83  Vibrio harveyi
1XKP_B        83 GWLGE---SQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLA 122 Yersinia pestis
Q52095        83 GWLGE---NQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLA 122 Yersinia enterocolitica
AAS94480      81 GMHG----GQAVVLTRLDGRTATAVDVENAAVLLAGVLDRATA 119 Desulfovibrio vulgaris str. Hildenborough
CAE42533      83 SLWSEgseDWIVAQTRLPERSLDAAALRLAVLGLTNWLDRLEA 125 Bordetella pertussis Tohama I
AAQ60271      82 YILRD---QQVLSCAPSAG---SETNHWLACVQTMRRLLEATA 118 Chromobacterium violaceum ATCC 12472
WP_003113546  83 AWSGE---SRLLLCITLEARQVGMPTLHQALQALRSARSEVLA 122 Pseudomonas
AAS13315      84 GLLDE---QTMVFSAQIEGDEVTLPTIEQAFALLVRLHKDVVG 123 Vibrio harveyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap