Conserved Protein Domain Family
type_III_YscX

?
TIGR02502: type_III_YscX 
type III secretion protein, YscX family
Members of this family are encoded within bacterial type III secretion gene clusters. Among all species with type III secretion, those with this protein are found among those that target animal rather than plant cells. The member of this family in Yersinia was shown by mutation to be required for type III secretion of Yops effector proteins and therefore is believe to be part of the secretion machinery. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131554
View PSSM: TIGR02502
Aligned: 4 rows
Threshold Bit Score: 178.058
Threshold Setting Gi: 499418434
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE16135       1 MSKIA-AAHIGIEQLTAISREEIEVSLPDRYALLPDGQSVETHAARLYPANKADQALLAFACPQDGFHALLRPHDFRQAV 79  Photorhabdus lu...
P61416         1 MSRIItAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLERLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRREL 80  Yersinia pestis
CDH71008      43 MSRVG-AWHIGIERLDLAHAEPFAPPLPERHLLAPDGRPVETHVASLYPAQQAQQRLFDYARPQLEFHGLLRPGDFRQAL 121 Pseudomonas aer...
WP_011105898   2 MTRVS-TLNVGIEAFTHVSHGEVDTDFPKRFQLLPDGQAVATHLEKLYDLRPSDQYLLALAKPKLNHCELLRPEKYRQQF 80  Vibrio parahaem...
CAE16135      80 SG----LRTILQQGNDIRVQHAVSLLENMNQDEQLLQMALHLLHKV 121 Photorhabdus luminescens subsp. laumondii TTO1
P61416        81 DT----LQSLLTTSQSSELQAAAALLKCQQDDDRLLQIILNLLHKV 122 Yersinia pestis
CDH71008     122 RD----LRLALTLPRQPALQAAACLLGERDEDERLLQMALNLLHKV 163 Pseudomonas aeruginosa MH38
WP_011105898  81 DNtlarVQQLAQESGSANLAKAAETLQSTQLDQRYLTMALNLLIQV 126 Vibrio parahaemolyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap