Conserved Protein Domain Family
yscI_hrpB_dom

?
TIGR02497: yscI_hrpB_dom 
type III secretion apparatus protein, YscI/HrpB, C-terminal domain
This model represents the conserved C-terminal domain of a protein conserved in across species in the bacterial type III secretion apparatus. This protein is designated YscI (Yop proteins translocation protein I) in Yersinia and HrpB (hypersensitivity response and pathogenicity protein B) in plant pathogens such as Pseudomonas syringae. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131549
View PSSM: TIGR02497
Aligned: 6 rows
Threshold Bit Score: 47.8353
Threshold Setting Gi: 488285579
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAQ60257      74 PAEMLAAQSKLLHSIVEVDLVAKTAGALSQGVNKLVSMQ 112 Chromobacterium violaceum ATCC 12472
AAC38380     104 PEDVLTLQKNVLNANVNVDVVSKLASLLSTSVTKLVSMQ 142 Escherichia coli
CAA12195      44 PQVMLTRQMDYMQLTVGVDYLARISGAASQALNKLDNMA 82  Salmonella enterica subsp. enterica serovar Typhimurium
AAQ20007      86 PGDIVQMSRALSQCSLQMALTTKVVSKSAQALDKLTNLQ 124 Pseudomonas syringae pv. maculicola
WP_003087732  69 PNSLMQMQWSLMRITMQEELIAKTVGRMSQNVETLMKTQ 107 Pseudomonas aeruginosa
WP_002356787  43 PESLLMQQAEWMHASLAIDLTAKVAGVMGQNINKLVNMQ 81  Yersinia pseudotuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap