Conserved Protein Domain Family
PFLA

?
TIGR02493: PFLA 
pyruvate formate-lyase 1-activating enzyme
An iron-sulfur protein with a radical-SAM domain (pfam04055). A single glycine residue in EC 2.3.1.54, formate C-acetyltransferase (formate-pyruvate lyase), is oxidized to the corresponding radical by transfer of H from its CH2 to AdoMet with concomitant cleavage of the latter. The reaction requires Fe2+. The first stage is reduction of the AdoMet to give methionine and the 5'-deoxyadenosin-5-yl radical, which then abstracts a hydrogen radical from the glycine residue. [Energy metabolism, Anaerobic, Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 131546
View PSSM: TIGR02493
Aligned: 9 rows
Threshold Bit Score: 351.286
Threshold Setting Gi: 41400041
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9X767          7 RVHSVETMGTVDGPGIRFIVFMQGCLLRCQFCHNPDTWKIgTG-TERSAQDVFDEAIKYKEFWDAS--GGGVTVSGGEPL 83  Listeria monoc...
AAF18276       33 RIHSTEIGGAVDGPGVRFCAVLGGLRFACQYCHNPDSWFL-KNgRAVTLAEMMEEVASYADFLKRA--GGGITISGGEPL 109 Zymomonas mobi...
AAL94467        4 YINSFESFGTKDGPGIRFVVFMQGCPLRCLYCHNVDTWELkDKnYIYTPEEVLAELNKVKAFLS-----GGITISGGEPL 78  Fusobacterium ...
AAK02161        6 RIHSYESCGTVDGPGIRFILFMQGCLMRCQYCHNRDTWDL-HAgKEITVEELMKEVVTYRHFMNAS--GGGVTASGGEAV 82  Pasteurella mu...
BAD39099       18 RIHSVESCGAVDGPGLRFVVFVQGCPLRCRYCHNPDTWDP-GQgAEVTVGSLIEEIQSYVPYMKFS--GGGVTVSGGEPL 94  Symbiobacteriu...
BAB80860        5 RIHSLETMGLVDGPGIRFVVFMQGCGIRCAFCHNPDTWCKdKG-TEYTPEELVNKIKRFKTYFNAS--GGGVTFSGGEPL 81  Clostridium pe...
AAO79842        4 nVHSYESMGTFDGPGLRLVVFLQGCNFRCLYCANPDTIAG-KGgTPTPPEEIVRMAMSQRPFFGKR--GG-ITFSGGEPT 79  Bacteroides th...
AAS06905       18 NVHSTESLACLEGPGNRFLLFLNGCAARCLYCSNPDTWDEtVG-TPMTVGQLIKKIGNLKNYYINSvgGGGVTVSGGEPL 96  Neocallimastix...
nestle:BL0950  55 FVHSWDINTSVDGPGTRMTVFMSGCPLRCQYCQNPDTWKM-RDgKPVYLDAMIKKVDRYKDLFKAT--HGGITFSGGESM 131 Bifidobacteriu...
Q9X767         84 LQVDFLIEFFTLCKA-AGVHTTIDSCGgcftRDPefIEKLDRLMEVTDLILLDIKQINPEKHLKLTTK-SNAPIIDFAHY 161 Listeria monoc...
AAF18276      110 VQPEFTGALLKAAKY-LGLHTAIDTAG----FLG--AQADDALLSNTDLVLLDIKAFNDKRYKALTGV-ELQPTLAFAKR 181 Zymomonas mobi...
AAL94467       79 LQSSFVLEVFKLCKE-NGIHTALDTSG----YIF--NEQAKKVLEYTDLVLLDIKHIDKDMYKKLTSV-DLEPTLNFIKY 150 Fusobacterium ...
AAK02161       83 LQAEFVRDWFSACKK-EGIHTCLDTNG----FVRnyDHVIDELLDVTDLVLLDLKQLNDKIHQNLIGV-PNKRTLEFAQY 156 Pasteurella mu...
BAD39099       95 LQPDFVADLFAECRR-LFIHTALDTSG----FAP--PERARRVLEQTDLLLLDIKHPDLLRHKALTGV-DGRPPRTTARL 166 Symbiobacteriu...
BAB80860       82 LQPEFLLECLKLCKKe-GIHTTLDTAG------VglGN-YEEILEYVDLILFDVKETDPEKYKSLVGv-PIDKSLEFLKV 152 Clostridium pe...
AAO79842       80 FQAKALVPLVRELKE-RGIHVCLDSNG------GlwNEDVEELFKLTDLVLLDIKEFNPNRHQTLTGR-SNEQTIRTAAW 151 Bacteroides th...
AAS06905       97 TQFGFLSCFLYAVKKhLNLHTCVETTG------QgcTKAWNSVLPHTDLCLVCIKHAIPEKYEQITRTkKLDRCLKFLKE 170 Neocallimastix...
nestle:BL0950 132 MQPAFVSRVFHAAKE-MGVHTCLDTSG----FLN--TNYTDEMLEDIDLCLLDVKSGDEETYHKVTGG-TLQPTIDFGQR 203 Bifidobacteriu...
Q9X767        162 LRDKEQPIWIRHVLIPTKTDDPEDLTKLHEFIQTLPN-VKQVDVLPYHTMGVYKWKEMGIRYPLEGIEAPEEEVVALANK 240 Listeria monoc...
AAF18276      182 LAALKKPVWLRYVLVPGLTDNFNEIANLADFAATLGN-IERVDVLPFHKMGEYKWKASGLAYKLGDTQPPSPALVEDVRG 260 Zymomonas mobi...
AAL94467      151 LQEINKPTWIRYVLVPGYTDDIKDLNDWAKFVSQFDI-VKRVDILPFHQMAIYKWEKTNREYKLKDTPTPNKEQIQRAEE 229 Fusobacterium ...
AAK02161      157 LAKRNQPVWIRYVVVPGYTDADEDIHLLGHFIKDMKN-IEKVELLPYHRLGAHKWEAMGEKYELEEVNPPTKESLEHIKS 235 Pasteurella mu...
BAD39099      167 AAAMGIPIWIRYVVVPGWTDSPADVEALADLVQTLPT-VEKVELLPYHLLGRHKWEALGLPYGLDGVAPPSEETLARIRQ 245 Symbiobacteriu...
BAB80860      153 TQSMNKKMWIRHVVVPGYTDNKEDLMRIKNFVDGLNN-IEKVELLPYHVLGVNKYEGLNIPYRLEGVPPLDK---KWLKE 228 Clostridium pe...
AAO79842      152 LEEQGKPFWLRYVLVPGYSDFEEDIRALGEALGKYKM-IQRVEILPYHTLGVHKYEAMGQEYKMKGVKENTPEQLEKAAE 230 Bacteroides th...
AAS06905      171 LEKRNIPWWCRYVVLPGYTDSKEDIEALIELVKNSPT-CERIEFLPYPELGKNKWEELGIEYPLKNIKQLKKSEIKWICD 249 Neocallimastix...
nestle:BL0950 204 LAKAGKKIWVRFVLVPGLTDSEENVENVAKICESFGDaVEHIDVLGFHQLGRPKWHELRIPYPLENQKGPNAATRERVAN 283 Bifidobacteriu...
Q9X767        241 ILETS 245 Listeria monocytogenes
AAF18276      261 IFRDN 265 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
AAL94467      230 IFRKY 234 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
AAK02161      236 ILESY 240 Pasteurella multocida subsp. multocida str. Pm70
BAD39099      246 QLADR 250 Symbiobacterium thermophilum IAM 14863
BAB80860      229 LEKEI 233 Clostridium perfringens str. 13
AAO79842      231 VFKEY 235 Bacteroides thetaiotaomicron VPI-5482
AAS06905      250 MVREA 254 Neocallimastix frontalis
nestle:BL0950 284 QFKDH 288 Bifidobacterium longum NCC2705
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap