Conserved Protein Domain Family
flgE_epsilon

?
TIGR02489: flgE_epsilon 
flagellar hook protein FlgE, epsilon proteobacterial
Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the Proteobacteria (Helicobacter, Wolinella, and Campylobacter). These proteins differ significantly in architecture from proteins designated FlgE in other lineages; the N-terminal and C-terminal domains are homologous, but members of this family only contain a large central domain that is surface-exposed and variable between strains.
Statistics
?
PSSM-Id: 131542
View PSSM: TIGR02489
Aligned: 3 rows
Threshold Bit Score: 969.034
Threshold Setting Gi: 3286760
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAP78301   1 MLRSLWSGVSGMQAHQIALDVESNNIANVNTVGFKYSRASFVDMLSQIKLIATSPYKnGLGGQNDFSVGLGVGIDATTKV 80  Helicobacter hepati...
CAE10780   1 MLRSLWSGVSGMQAHQVALDVEGNNIANVNTTGFKYSRANFSDMLSQVNRIATSPYG-GLGGQNDYSIGLGTSINSTTKI 79  Wolinella succinogenes
CAA05173   1 MMRSLWSGVRRLQAHQVAMDVEGNNISNVNTTGFKYSRADFGTMFSQTVKIATTPTD-GRGGQNPLQIGLGVSVSSTTRI 79  Campylobacter jejuni
AAP78301  81 FSQGNTQNTDVKTDVAIEGDGFFIISPDRGTTHNYTRNGEFLFDANGNLVTTGGYVVQGWVRpPLEAAESGTMSDFDFFR 160 Helicobacter hepati...
CAE10780  80 FGQGSIQDTTNKMDLAIGGDGFFIVSGNGGRTNAYTRDGAFGFDAAGNMVNNAGYIVQGWTR-DLNSGSTSCYSDALYNV 158 Wolinella succinogenes
CAA05173  80 HSQGSVQTTNSNTDVAINGDGFFMVSDDGGLTNYLTRDGAFKLDAYGNFVNNSGFIVQGWNI------------NWDDQT 147 Campylobacter jejuni
AAP78301 161 VDNTGPVRNIQIDPGMVMPARATKTITLRANLNAGRHIDQMQ-DVAALDSTA------QTAAD----GVVAIYDSRG--- 226 Helicobacter hepati...
CAE10780 159 VDTTVPISGIKIEPKMVIPAKATTQVNLDANLTAGDTTDKLG-CMYALDSTS------VTAAD----GIAARYDSAG--- 224 Wolinella succinogenes
CAA05173 148 IDSSRSPQNIFIDPGMHIPAAKSTEVAIKANLNSGLNIGTSSrNLYALDSVHgynnktQRAEDendtGTTQFYTTSKnsv 227 Campylobacter jejuni
AAP78301 227 VLTQVGEDLGVLFNDDGDAFALNENQGIWLSYKTAAIRHETVVTNEVs---------------------TIGINGEKVSF 285 Helicobacter hepati...
CAE10780 225 NKIQMAEDMGVLFNASGNALKLSEGQGVWVSYSQATATQAVAVATTG----------------------TITLNGTTITF 282 Wolinella succinogenes
CAA05173 228 EVTEKGVDAGSLFNASGTGLNLRDGQGIWVSYADAKYSTNKVGVSAFdanlqqnqtaafwgsadqrvnlDITLNGVRIQN 307 Campylobacter jejuni
AAP78301 286 SNNSAITGVSSIVAAQNAINSLRDKTGVNAYVDAG--QLRIENRNQMDGGEKVKNIRITSGGt---GVLQN--------- 351 Helicobacter hepati...
CAE10780 283 TNDSTISGVSSLVAAQNAINAKKSETGVEAFATGG--QLRLVNDNSLDGNASKKNVIITASG----GALAN--------- 347 Wolinella succinogenes
CAA05173 308 AEIQNIDDAIAYINTFTAPTDTRDGTGVRAVKSADgsGIEFVNDNSDGTTDNMKNINLIVSDantaGELWNavwdpalng 387 Campylobacter jejuni
AAP78301 352 ---FVQGEED--------------------------------------ITAFRYRYTKS-------------------ED 371 Helicobacter hepati...
CAE10780 348 ---FTAADNS--------------------------------------ITAFRYAYTTA-------------------SD 367 Wolinella succinogenes
CAA05173 388 qggFTFNQNTpaitrngtslwtadqitpnntpdgntavtltgtdrvevITAHKYIYSSNpvdigpmynpdggpsftddDG 467 Campylobacter jejuni
AAP78301 372 ADST----------------------TGQFRTTEDLRALIQYDANM-IKNPEkTYYEST---ATVGVTINRWGMFEIANH 425 Helicobacter hepati...
CAE10780 368 ADST----------------------SRLFRTTEDLRALLQQDANN-IKHGG-GYVDSTgtnASVKVTINKTGMFEILNQ 423 Wolinella succinogenes
CAA05173 468 VDTTrptdpasaaywdamnggllntnARTFRTTEDLRELLQRDARYgVDYDGsGNFAAAdvnQAVKVVVTANGNFAISNA 547 Campylobacter jejuni
AAP78301 426 DDAD---------------DEQRNLSLYVTSHFSDN--VTNNVLFKETMKALNTASLIEGGAAVNTGKIVKATHATSVDI 488 Helicobacter hepati...
CAE10780 424 DDGD---------------TTTGNLSLTVSSYYDTN--VTSNVLFKSAMKGLNTGILVEGGSSTTSASLMAAKHTATTDI 486 Wolinella succinogenes
CAA05173 548 KENSsipanagtgitgaitTEPKAMSFNITAYSNKAgtVTTNDAFTAIFKAWD-GPLTVGGSIKESEQLKLSAFSAGLEI 626 Campylobacter jejuni
AAP78301 489 VDSLGSKHNVRFEFWKT-----GDAVWSFRAIVPEPAQFIGGSITKPNVFEGGRASFNSDGSLSGMNPPVLQFDPKNGSK 563 Helicobacter hepati...
CAE10780 487 VDSLGNKHTLTVTFRKV-----GPQEWSFSLHVPEPATFVNGSGERPNYFEGGRVTFGEDGGLTGMNPPTIQFNPKSGAS 561 Wolinella succinogenes
CAA05173 627 FDSLGSKHTLEVQFVKQsttqdGGNEWQMIIRVPEPAEIN-TTGEGQIISSVGTARFNNDGSLASYTPRTINFSPNNGAA 705 Campylobacter jejuni
AAP78301 564 GPQRLELKFGANETFGGLTSVDKISETYSINQNGYQAGDLMD--IRFDSNGSLLGAFSNGRSIALAQVALANFANNAGLQ 641 Helicobacter hepati...
CAE10780 562 SPQRIDLDFGVSGTFQGLTSTDKESATGNIYQNGYQSGVLED--WRFDSNGVLIGEFSNGKDLALAQVAIASFTNNGGLQ 639 Wolinella succinogenes
CAA05173 706 PNQQIKLSFGTSGSNDGLVSSNSASTLTGQATDGYSSGNLKPdaIRVDEKGNLLGEFTNGKTFRVAKIAMASVANNSGLE 785 Campylobacter jejuni
AAP78301 642 AEGGNVYSQTGNSGEPMVGAANTGRRGGVSGSKLEMSNVDLSRSLTQLIVVQRGFQANSKAVTTSDQILNTLLNLKQ 718 Helicobacter hepaticus...
CAE10780 640 AEGSNLFSQTANSGEPVVGTAGSGGRGKISPSALEMSNVDLSRSLTQLIVVQRGFQANSKTVTTSDQILNTLLQLKQ 716 Wolinella succinogenes
CAA05173 786 EIGGNLFKVTANSGNIVVGEAGTGGRGEMKTSALEMSNVDLSRALTELIIIQRGYQANSKTISTSDQMLQTLIQLKQ 862 Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap