Conserved Protein Domain Family
flgG_G_neg

?
TIGR02488: flgG_G_neg 
flagellar basal-body rod protein FlgG, Gram-negative bacteria
This family consists of the FlgG protein of the flagellar apparatus in the Proteobacteria and spirochetes. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 131541
View PSSM: TIGR02488
Aligned: 12 rows
Threshold Bit Score: 380.931
Threshold Setting Gi: 32447913
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD77433       5 TLYTAATGMEAMQTKLDVIANNLANINTTGFKKDRANFEDLLYRTEVYPGVQDS-TQTPTAVGTQVGLGVRVTSTQTDQR 83  Rhodopirellula ...
AAD19724       5 PLQVARTGLDAQNTRMRIIANNLANVNTTAFKRDRAAFETLAYQAERQPGAQST-NSYYYATGLTLGSGVQTIATERQET 83  Zymomonas mobil...
tigr:BMA3330   4 SLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPGANST-QQTELPSGLQLGTGVQQVATERLYT 82  Burkholderia ma...
AAD42917       4 ALWVSKTGLDAQQTNIATISNNLANASTVGYKKSRAVFEDLFYQNINQPGGQSS-QNTELPSGLMLGAGSKVVATQKVHT 82  Vibrio parahaem...
BAC61612       4 ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPGAQVD-QVNELPSGVQLGSGVRVVGTQKVFT 82  Vibrio parahaem...
AAG29749       5 AMHVASTGLNAQQTRMQVISNNLANVNTTGFKRDRANFESLLYQTWKPGGAQTS-EATAMTSPSAVGTGVRVVSTEKLYT 83  Rhodobacter sph...
BAC51093       3 ALHTAATGMAAQELNVQVISNNIANLRTTGFKKQTAAFQDLIYEHVRRVGAQASdQGTIVPVGVDIGGGVKTVGTPRSMT 82  Bradyrhizobium ...
AAS11497       4 SLWTAATGMNTQQANIDTVANNLANVNTSGFKKQRAEFEDLIYQTVKTAGTPATeD-TITPVGVQMGHGARLAATQRIFE 82  Treponema denti...
AAS94995       4 SLWTAATGMVAQQLNIDVISHNLANVNTSGFKKSRAEFEDLMYQNMRIAGSATEgD-SRIPVGIQVGMGVRPTAVHKFFS 82  Desulfovibrio v...
CAE78507       4 SLNTAATGMAAQQTNMDVIANNIANVSTAGFKRSRAEFEDLMYQTQKEPGTASGlN-AYSPNGVQVGLGVRTAGVQKDFA 82  Bdellovibrio ba...
CAE10819       4 ALYTATTGMMGQQLQIDVTSNNIANVNTIGYKKQRAEFADLFYQVMEYAGSSTSeT-TLSPTGIEVGLGVRPTAITKIFS 82  Wolinella succi...
Q52946         3 ALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLYQTERAQGVPNRsNQAIVPEGAIIGLGVQTSAVRNLHI 82  Sinorhizobium m...
CAD77433      84 QGTLQQTGRDLDVAIQGGGYFRVVDPSSQdTMYTRAGNLDINANGELVMGsaqVGRLLDPPITIPPDATA--VVINSNGE 161 Rhodopirellula ...
AAD19724      84 QGSFVNTGNSLDLAVSGVGYFQIQLPDGT-IGYTRAGNFQLSQDGQIVTD---DGKPLIPNINIPQNAEQ--ITIGEDGT 157 Zymomonas mobil...
tigr:BMA3330  83 QGSLQQTGNSKDVAINGQGFFQVLMPDGT-NAYTRDGSFQTNAQGQLVTS---SGYQVIPAITIPQNANS--LTIGSDGV 156 Burkholderia ma...
AAD42917      83 HGNAQTTTNALDMMVEGDGFFQVTLPDGN-IGYTRNGQFTLNGEGTLVTSg--SGYPVEPEIVIPEDAIS--ITVGTDGE 157 Vibrio parahaem...
BAC61612      83 QGNTQNTTQDLDLAVMGQGFFQIENSDGQ-IMYTRNGQFHINSEGLMVNS---QGLPLEPQIQIPDNATS--FSVGVDGT 156 Vibrio parahaem...
AAG29749      84 QGSLANTDNALDLAIDGPGFFQVLMPDGR-MGYTRNGTFSQNAEGTITTP---SGYVVQPEIQIPEGAVS--VTISSDGI 157 Rhodobacter sph...
BAC51093      83 QGTLSQTGNDLDLAISGEGFFKILMPDGT-FQYTRDGTFQMDNQGRVVTA---QGNPVQPTITIPNNASG--LTVNEQGQ 156 Bradyrhizobium ...
AAS11497      83 QGSLQNTGVTSDIAIQGEGFFRVLQYDGT-YAYTRDGSFKIDADRQLVTS---NGLRVLPEIIFPEGYREntIAVSRDGR 158 Treponema denti...
AAS94995      83 QGDFQNSGNPLDIAIEGDGFFQVLVN-GE-PRYTRAGAFKLNQDGTVVTA---NGYVLQPEFTVPAETKN--VVVTEAGH 155 Desulfovibrio v...
CAE78507      83 GGQAQITKNPLDLQIEGSGFFQVLTADGE-TAYTRDGAFKKDPNGRLVDK---NGNTLQPEITVPANVSG--IEVAPTGE 156 Bdellovibrio ba...
CAE10819      83 QGNFKETGNNLDIAITGNGFFQIQLPDGT-TAYTRNGAFKPDDEGNIVNS---DGYRLIPEITIPEDATQ--INIGVDGT 156 Wolinella succi...
Q52946        83 QGSLVNTGNDYDLALVGRGWFQIETPDGE-TVYTRSGAFNTNATGQLVTI---DGYTVVPGVTVPQDATE--IVFTSSGQ 156 Sinorhizobium m...
CAD77433     162 VMVRQPGQTELTNQGQIQLAQFINPDGLLKNGENLYSETDASGPEQINNPGTDGMGVLRQGNLEASNVEPVQELIDLITT 241 Rhodopirellula ...
AAD19724     158 VSVQLQGQTQSNQVGQIQTVRFINPAGLQATGQNLYIETQSSGQPQIGLPQQDGMGYILQGELEQSNVNIVQELVDMIET 237 Zymomonas mobil...
tigr:BMA3330 157 VSVTQPGSNNAVQIGALQIATFINPAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESSNVNVVQELVNMIQT 236 Burkholderia ma...
AAD42917     158 VSVRVRGQQDNQVVGQLTITDFVNPGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEA 237 Vibrio parahaem...
BAC61612     157 VTTTTADDPTPQQLGQITLAKFINPAGLEAVGGNLFRETEASGPADELIAGADGAGSIKQGALEGSNVQVVEEMVDMITT 236 Vibrio parahaem...
AAG29749     158 VSVLMPDETEAQEVGQMTLATFANPRGLQPVGETFAVETGASGEAVIGNPVEPGFGKLVQGSLEASNVNVVQELVDMIET 237 Rhodobacter sph...
BAC51093     157 VSVTLPGSSTSAVQGQLGLTRFINKAGLQPVGNNQFTETPSSGPPQDGTANTEGYGKITQGSLEQANVDVVSEMSDLIAA 236 Bradyrhizobium ...
AAS11497     159 VTVKVGDIDDPIEVGQIELYRFQNNAGLSAEGSNLFRQTPASGTAIPGRPGFTGFGRTEHKFLEMSNVSTVSEMVNMIVA 238 Treponema denti...
AAS94995     156 IAALDANGQE-LAAADIPLYTFINPAGLDAIGRNLYVPSEASGEAVEGVPGEDNVGTLAQGFLEMSNVEVVDEMVNMIVG 234 Desulfovibrio v...
CAE78507     157 VRVITGLNDVPQTIGQIDVVNFVNPAGLKAMGKNLFTQTPSSGQAIASRPGLNGTGYLAQGQLESSNVNIVDEMVNMITA 236 Bdellovibrio ba...
CAE10819     157 VSVLQGNQTEVNTIGQIEIATFINPAGLHSLGDNLYLNTNASGDPIVDTPGLNGFGQLRQGFVELSNVKLVEEMTDLITG 236 Wolinella succi...
Q52946       157 VMVRIGNDTELQEIGQLTIANFVNEAGLEPMGENLFRQTPASGDPIVGTPADPGFAQVKQNYLESSNVDPVKEITDLISA 236 Sinorhizobium m...
CAD77433     242 QRAFELNSQAVQAGDQVMQNISQLR 266 Rhodopirellula baltica SH 1
AAD19724     238 QRAYEVNSKMVKASDEMLQYINQQI 262 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
tigr:BMA3330 237 QRAYEINSKAVTTSDQMLQTVTQMS 261 Burkholderia mallei ATCC 23344
AAD42917     238 QRVYEMNSKVISSVDKMMSFVNQQL 262 Vibrio parahaemolyticus
BAC61612     237 QRAYEMNAKVVSAADDMLKFVSQSM 261 Vibrio parahaemolyticus RIMD 2210633
AAG29749     238 QRAYEVNSKSISASDEMMQYLSNKL 262 Rhodobacter sphaeroides
BAC51093     237 QRAYEMNAKVISAADQMMQSTTALF 261 Bradyrhizobium diazoefficiens USDA 110
AAS11497     239 QRAYEFNSKAIQTSDNMLGTAVSLK 263 Treponema denticola ATCC 35405
AAS94995     235 QRAYEMNSKAISTSDQMLQTAVNLK 259 Desulfovibrio vulgaris str. Hildenborough
CAE78507     237 QRAMETNSKVMQASDQMLQAINNLR 261 Bdellovibrio bacteriovorus HD100
CAE10819     237 QRAYEANSKSIQTADSMLQTVNSLK 261 Wolinella succinogenes
Q52946       237 QRAYEMNSKIIQAADEMAATVSKNL 261 Sinorhizobium meliloti 1021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap