Conserved Protein Domain Family
fliN

?
TIGR02480: fliN 
flagellar motor switch protein FliN
Proteins that consist largely of the domain described by this model for this protein family can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 131533
View PSSM: TIGR02480
Aligned: 17 rows
Threshold Bit Score: 89.9641
Threshold Setting Gi: 6225365
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS66686  98 NMDLIMDIPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDddtRFGVKLIEVMSTR 177 Agrobacterium sp. H...
AAF35847  30 DLESVYDIPVQISAVLGKCTMQVSSLMKLGRGAVVELDRKVGEAIDIYVNNRLVARGEVVVVED---RLGVTMTEIIKSD 106 Rhodospirillum cent...
AAK83160  26 EISAIYDTEVEVSVVLGTSTIRVRDLLKLGRGAIVELDRKIDDLSDIIVSGRMVGRGEVTIVED---KIAVTFREFARVS 102 Rhodospirillum cent...
O67495    35 LIQHFSDIPVEVEVVVGRANKTLGELLAMGIGSVIEIDREPKDLVDIKVNGKLIAKGELVIIDG---KIGVKIKEVVKEq 111 Aquifex aeolicus VF5
AAO36259 331 NIDLIMDVPLDISVVLGRTKLNIKEILNLGTGSLIELDKLAEEPVEILVNGKPVAFGEVVVIDE---NFGVRITDIVNNV 407 Clostridium tetani E88
AAP77745 194 NINMILDVRLNVKVRIGQKRMLLKDVIAMDIGSVIELNQLANDPLEILVDDKVIAKGEVVIVDG---NFGIQITDIGTKR 270 Helicobacter hepati...
AAS70432  99 NLNLLMDVNLALTVELGRTNMFIKDVNGLNEGVVVELDKNVGEDLDILANGRLVGRGKLVAMDD---FYGIQITEIVDQS 175 Leptospira interrog...
Q89AZ3    53 KMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTEN---KYGIRIINIIDNS 129 Buchnera aphidicola...
AAP78174  30 NYTGLLDMEALFNAELGSTKIPLGEILRFEKGSIIDLGKPAGESVEIFINGRVIGKGEVMVYER---NLAIRINEILDSN 106 Helicobacter hepati...
BAD40998 146 LRGVLLDIELTLSVELGKARLPLGEILSMGPGSVITLDRLASEPLNVKVNGLPAMTAEVIAIGE---KYGIRIVESQLPN 222 Symbiobacterium the...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap