1KZH


Conserved Protein Domain Family
PFKA_PPi

?
TIGR02477: PFKA_PPi 
Click on image for an interactive view with Cn3D
diphosphate--fructose-6-phosphate 1-phosphotransferase
Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyzes the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (EC 2.7.1.90). The enzyme is also known as pyrophosphate-dependent phosphofructokinase. The usage of PPi-dependent enzymes in glycolysis presumably frees up ATP for other processes. TIGR02482 represents the ATP-dependent 6-phosphofructokinase enzyme contained within pfam00365: Phosphofructokinase. This model hits primarily bacterial, plant alpha, and plant beta sequences. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 131530
View PSSM: TIGR02477
Aligned: 11 rows
Threshold Bit Score: 834.301
Threshold Setting Gi: 29834717
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KZH_A         6 FKQERQKYIPKLPNILKKdFNNISLVYGENTEAIQD-RQALKEFFKNTYGLPIISFTEGESSl------SFSKALNIGII 78  Borrelia burgdo...
AAG37271       7 LQKARYGYVPKLPPVLQDeIARIQAELGQPTEAVAD-REDLKRLFANTYGKPIATLTRGSNP-------EAGRRRTVGVI 78  Spirochaeta the...
AAO75414       6 LQIARAAYQPKLPKALA--TGAVKAVAGAATQSVAD-QEAIKALFPNTYGMPLITFEAGEAV-------QLP-AMNVGVI 74  Bacteroides the...
AAC04465       6 LHKYRLQYKPVLPKHIAD-IDNITIEEGAKTQSAVN-QKELSELFKHTYGLPICNIVAGKNA-------DIHRVIRCGFI 76  Entamoeba histo...
AAS12067       6 MQRLRYNYEPKIPKVFAEpLSLIKPEIGEATHAQSN-QAELKEIFPHTYGMPIIRFVKGKSE-------VEHKPLKFGVI 77  Treponema denti...
Q41141        16 VQSSRIEHVLPLPSVLN---HPFKIVQGPPSSAAGN-PDEIAKLFPNLFGQPSAMLVPDVADs-----lDSNQQLKIGLV 86  castor bean
AAL16943       4 FELYRRQYNPLLPASLQG--TGYTLKKGEPMAPVAD-GEEIAKQFPMTTNLPAISIEPSTEQs------KLLEPLTIGVI 74  Hexamita inflata
AAP05352      11 FELQRLHYRPETLSFLNG---ITSLHIVDSTEPPAI-PKNLQEHIPNLCSIPEVTIEKGEATp--------SQPLKIGVL 78  Chlamydophila c...
AAC67587      14 LQQLRSLYQPELPPCLQGtTVRVEFGDSTTTADPAD-THSISRSFPHTYGQPLAHFLRATAKvpdaqiiTEHPAIRVGIV 92  Citrus x paradisi
WP_010230546   5 KHSSLCQKTPPLCRELQKaPALLLTEDTRFSALLNDrVETVAQLFPCTYESPYRKFIPKSDLp------LDIAPLKVGVM 78  Chlamydia murid...
jena:BG0020    6 FQQERKKYVPKLPNILKKdFKNISLVYGEKTEAIQD-RQALKEFFKNTYGLPIVSFTEGESSn-----lSFSKALNIGII 79  Borrelia garini...
1KZH_A        79 LSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKA 158 Borrelia burgdo...
AAG37271      79 LSGGPAPGGHNVICGLFDALKKANRESTLIGFKGGPSGILDDEWIEFTDSLINQYRNTGGFDIIGSGRTKIETPEQFAKA 158 Spirochaeta the...
AAO75414      75 LSGGQAPGGHNVISGLFDGIKKLNPESKLYGFILGPGGLVDHNYMELTADIIDEYRNTGGFDIIGSGRTKLETEAQFEKG 154 Bacteroides the...
AAC04465      77 LSGGPAAGGHNVVAGLFDGLMKGNKENKLYGFRCGAGGILSNDYIEITAELVDKHRNTGGFDLVGSGRTKIETEEQFATA 156 Entamoeba histo...
AAS12067      78 LSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPEGLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESS 157 Treponema denti...
Q41141        87 LSGGQAPGGHNVISGIFDYLQDRAKGSILYGFRGGPAGIMKCNYVQLTADYIHPYRNQGGFDMICSGRDKIETPEQFKQA 166 castor bean
AAL16943      75 FSGGQAPGGHNVLCGLYDKLQQLAPNSKLLGFLGGPKGLMDNKHMILTKEYLATFRNMGGFHAIGSGRDKIASTKDFDAA 154 Hexamita inflata
AAP05352      79 LSGGQAPGGHNVVIGLFEGLRAFNPKTKLYGFIQGPLGLTRGLYKDLDISVIYDYYNVGGFDMLSSSKEKIKTKEQKSTI 158 Chlamydophila c...
AAC67587      93 FCGRQSPGGHNVVWGLYDAIKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEIFSTYKNQGGYDMLGRTKDQIRTTEQVNAA 172 Citrus x paradisi
WP_010230546  79 LSGGPAPGGHNVILGLLHSIKKLHPHSKLLGFIRNGHGLLNNNTVEITEEFMKEFRNSGGFNCIGTGRTNIITEENKARC 158 Chlamydia murid...
jena:BG0020   80 LSGGPAPGGHNVISGIFDAIKKFNANSKLFGFKGGPLGLLENDKIELTESLVNSYRNTGGFDIVSSGRTKIETEEHYDKA 159 Borrelia garini...
1KZH_A       159 LFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRN-DHIEISFGFDSATKIYSELIGNLCRD 237 Borrelia burgdo...
AAG37271     159 LENAKKHGLDALVIIGGDDSNTNAALLAEYFVQQGAPIQVIGIPKTIDGDLKN-EYIEASFGFDTATKVYAELIGNIARD 237 Spirochaeta the...
AAO75414     155 FEIIKELGIKALVIIGGDDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKN-DMIETSFGFDTACKTYAEVIGNIQRD 233 Bacteroides the...
AAC04465     157 FKHITALKLNAMVVVGGDDSNTNAALLAEYFAAHGSDCVFVGVPKTIDGDLKN-QYIETSFGFDTACKTYSELIGNIQRD 235 Entamoeba histo...
AAS12067     158 IQNVKKLKLDALIIIGGDDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKN-QYIETSFGFDTATKLYSELIGNICRD 236 Treponema denti...
Q41141       167 EETAGKLDLNGLVVIGGDDSNTNACLLAENFRSKNLKTRVIGCPKTIDGDLKC-KEVPTSFGFDTACKIYSEMIGNVMID 245 castor bean
AAL16943     155 ANTAAVEKLDGLVIIGGDDSNTNACLLAEDFIKRGLKTRVIGVPKTIDRDLISkRGIETSFGFDTSCKVYSELIGNLCYD 234 Hexamita inflata
AAP05352     159 LTTVKKLKLDGLLIIGGNNSNTDTAMLAEYFLKHNCTIPIVGVPKTIDGDLKN-FWIETPLGFHTSCRIYSEMIGNLEKD 237 Chlamydophila c...
AAC67587     173 LTACKNLNLDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKN-QFVETNVGFDTICKVNSQLISNVCTD 251 Citrus x paradisi
WP_010230546 159 LQTANQLDLDGLVIIGGDGSNTATAILAEYFAKHRAKTVLIGVPKTIDGDLQH-LFLDLTFGFDTATKFYSSIISNISRD 237 Chlamydia murid...
jena:BG0020  160 LLVAKENNLNAIVIIGGDDSNTNAAILAEYFKKKGENIQVIGVPKTIDADLKN-NHIEISFGFDSATKIYSEMIGNLCRD 238 Borrelia garini...
1KZH_A       238 AMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEF 317 Borrelia burgdo...
AAG37271     238 AISSRKYWHFIRLMGRSASHIALECALQTHPNVCIVSEEVREKNMTLSQIVDQIVDAVVKRAAKGENFGVVLVPEGLIEF 317 Spirochaeta the...
AAO75414     234 CNSARKYWHFIKLMGRSASHIALECALQVQPNVCIVSEEVEEKDMSLDDVVTSIAKVVADRAAQGNNFGTVLIPEGLVEF 313 Bacteroides the...
AAC04465     236 AISSRKYWHFIKVMGRSASHIALEAALETQPTYCIISEEVEDKKMTVSQIASEIADIVIERHKKGLNFGVVLIPEGLVEF 315 Entamoeba histo...
AAS12067     237 VNSARKYWHFIKLMGRSASHIALECALKTQPNVCLIGEELAEKKVTLQQVTDYIVDIIVKRSQKGENFGVVLVPEGIIEF 316 Treponema denti...
Q41141       246 ARSTGKYYHFVRLMGRAASHITLECALQTHPNITIIGEEVAAKKLALKDVTDYIVDVICKRADLGYNYGVILIPEGLIDF 325 castor bean
AAL16943     235 ALSAKKYWHFIRLMGRSASHITLECGLQTHPNICLIGEEILAKNMTSKQVFEYMADIIAQRAANGKNYGICLIPEGLIEF 314 Hexamita inflata
AAP05352     238 TLSIKKYHHFVRLMGQKASYTTLECGLQTLPNVTLISEHIAMRKISLQKLSEHIAMGLVNRYRSGKNYSTILIPEGLIEH 317 Chlamydophila c...
AAC67587     252 ALSAEKYYYFIRLMGRRASHVALECTLQSHPNMVILGEEVAASKLTLFDLTKQICDAVQARAEQDKNHGVILLPEGLIES 331 Citrus x paradisi
WP_010230546 238 ALSCKGHYHFIKLMGRSSSHITLECALQTHPNMALIGEEIAEKGTSLSALIQGICEMISDRAAMGKYHGVILIPEGVIEF 317 Chlamydia murid...
jena:BG0020  239 AMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSEEVLAKKKTLFEIVDEMVFVILKRSLNGDNFGIVIVPEGVIEF 318 Borrelia garini...
1KZH_A       318 IPEVKSLMLELCDIFDKNEGEfkg-lniEKMKEIFVAKLSDYMKGVYLSLPLFIQFELiksI---LERDPHGNFNVSRVP 393 Borrelia burgdo...
AAG37271     318 IPEVGALIDELNTLLAKEAEVfnriddpRERISWVKGKLSGNNQHVFSSLPETIQAQL---L---MDRDPHGNVQVSRIE 391 Spirochaeta the...
AAO75414     314 IPAMKRLIAELNDFLAANAEEfsqikksHQRDYIIR-KLSPENSAIYASLPEGVARQL---T---LDRDPHGNVQVSLIE 386 Bacteroides the...
AAC04465     316 IPEVIALIKELNNLLAHKKEEyskitefSAQKAFVCENISESCAATFKNLPDNIRKQL---L---LDRDPHGNVNVSAIE 389 Entamoeba histo...
AAS12067     317 IPEMDELIEEINDIMAEKTSAfsklktfAGKKSWLQKHLSKKAFALFDNLPENISLQL---L---MDRDPHGNVQVSRIE 390 Treponema denti...
Q41141       326 IPEVQNLIAELNEILAHDVVD---------EGGLWKKKLTSQSLQLFEFLPVAIQEQL---M---LERDPHGNVQVAKIE 390 castor bean
AAL16943     315 IPENNKLFDYLNNKLLPGWQG-------EITAELVAQKLPADLKVTFESIPPTIRTQL---L---LDRDPHGNIAISQIE 381 Hexamita inflata
AAP05352     318 VFDTRKLVNELNVLLLDNNLN----------LDNVQSKLSPESLKTLSSLPIEIAHQL---L---IARDSYGNVRVSKIA 381 Chlamydophila c...
AAC67587     332 IPEVYALLKEIHSLLRQGVPV-----------DNISSQLSPWASALFEFLPPFIKKQL---L---LYPESDDSAQLSQIE 394 Citrus x paradisi
WP_010230546 318 IPEIQTLVKEIESFPEQTDLS---------------QALSPSSQQLLHQFPEDIRHQL---L---YNRDAHGNVYVSQIS 376 Chlamydia murid...
jena:BG0020  319 IPEVKSLMVELCNIFDKNIVEfkg-lniEGMKEVFVAKLSDYMKKVYLSLPLFIQFEL---VnsiLERDPHGNFNVSRVP 394 Borrelia garini...
1KZH_A       394 TEKLFIEMIQSRLNDMKKRGEYKGS-FTPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAVVLILNGLTGYMSCIKNLNLKP 472 Borrelia burgdo...
AAG37271     392 TEKLLIEMVSSRLKALKEEGAYKGK-FSALNHFFGYEARCAFPSNFDADYCYALGFTAFVLIANGLTGYIAAIKNLARPA 470 Spirochaeta the...
AAO75414     387 TEKLLSEMVATKLAAWKEDGKYVGK-FAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPA 465 Bacteroides the...
AAC04465     390 TESFVSGIVK---AEIVKRG-IKVP-FTPVHHFFGYEGRCAFPSNFDSTYCYALGYTAFILLALKKTGQICCISGLQKPA 464 Entamoeba histo...
AAS12067     391 TEKLLIDLVTRKITEMKKEGTYNGK-FSTYAHFFGYEGRSAFPSNFDSDYCYTLGFTAFLLALNGFSGYIASVKNLTDEV 469 Treponema denti...
Q41141       391 TEKMLIQMVETELEKRKQQGTYKAH-FKGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGLISSVGNLGAPV 469 castor bean
AAL16943     382 TEKFLVSGVQ----QVIKERELKIK-FSALYHFFGYEGRCAAPSAFDSSYCYGLGSVAAVLLGNGITGYMSCLKNLSEQP 456 Hexamita inflata
AAP05352     382 TEELLAALIK----KEIQKIEPKME-FQPVNHFFGYESRAGFPSNFDANYGLALGIVSALFLVRQRTGYMVTINNLARSY 456 Chlamydophila c...
AAC67587     395 TEKLLAHLVEVEMNKRLKEGTYKGKkFNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVTNLKNPA 474 Citrus x paradisi
WP_010230546 377 VDKLLIHLVQN-----HLETHFKHVpFNAISHFLGYEGRSGTPTHFDNVYSYNLGYGAGILVFNRCNGYLTTIEGLTNPI 451 Chlamydia murid...
jena:BG0020  395 TEKLFIEMVQARLSEMKKRGEYKGS-FIPVDHFFGYEGRSAFPSNFDSDYCYSLGYNAAILILNGLTGYMSCIKNLNSKP 473 Borrelia garini...
1KZH_A       473 TDWIAGGVPLTMLMNMEERYGE------KKPVIKKALVDLEGRPFKEFVKNRDKWALNNLYLYPGPVQYFGSSEI----- 541 Borrelia burgdo...
AAG37271     471 VEWKPMGIPLTMMMNMEKRHGK------MKPVIRKALVDLEGAPFKRFATQRDAWATESAYVFPGAIQYYGPDDV----- 539 Spirochaeta the...
AAO75414     466 AEWIAGGVPITMMMNMERRHGE------MKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQYFGPTEV----- 534 Bacteroides the...
AAC04465     465 EEWICGGVPLTIMMNMEQRNGE------MKPVIKKALVEIEGKPFKFYQSKRAQWASAEDFVFPGAIQYFGPSEV----- 533 Entamoeba histo...
AAS12067     470 EHWLPCGVPLSMMMNMERRKGK------MTPVIKKSVVDLNGKPFKTYEKNRDKWAVETLYRFPGAIQYFGDLEV----- 538 Treponema denti...
Q41141       470 AEWTVGGTALTSLMDVERRHGK------FKPVIKKAMVELEGAPFKKFASLREEWALKNRYVSPGPIQFMGPG------- 536 castor bean
AAL16943     457 DKWIAGAIPLTSLMNIEMRHGA------RTAVIQKQMVDLAGRPFGFLVVNREKWAEQDCYQQPGPIQLIECQDVegrnv 530 Hexamita inflata
AAP05352     457 SEWIGGATPLYKMMQLEHRLGE------DTPVIKTDSVNPHAPEVQYLLNQSDACLMKDLYCFPGPLQYFGEERL----- 525 Chlamydophila c...
AAC67587     475 NKWRCGAAPITSMMTVKRWSQNpgassiGRPAINPATVDMRGKAYELLRQNATRFLLDDLYRNPGPVQFDGPG------- 547 Citrus x paradisi
WP_010230546 452 EKWRLRALPIVRMLTTKTNKDGt-----LYPLIKKGLVDISSPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDSh---s 523 Chlamydia murid...
jena:BG0020  474 TDWIAGGVPLTMLMNMEERYGV------QKPVIKKALVDLEGRPFKEFVENRDKWAFNNLYLYPGPVQYFGSSEI----- 542 Borrelia garini...
1KZH_A       542 VDEITETLKLEL 553 Borrelia burgdorferi B31
AAG37271     540 CNQPTMTLKLEQ 551 Spirochaeta thermophila
AAO75414     535 CDQATKTLQLEQ 546 Bacteroides thetaiotaomicron VPI-5482
AAC04465     534 CDQPTKTLLLEQ 545 Entamoeba histolytica
AAS12067     539 CDIPTKTLLLEK 550 Treponema denticola ATCC 35405
Q41141       537 SDAASHTLLLEL 548 castor bean
AAL16943     531 VYQSSVTLLEEA 542 Hexamita inflata
AAP05352     526 LDQRPLTLLWGN 537 Chlamydophila caviae GPIC
AAC67587     548 ADAKAVTLCVED 559 Citrus x paradisi
WP_010230546 524 DDFPPLILFLNH 535 Chlamydia muridarum
jena:BG0020  543 VDEITETLKLEL 554 Borrelia garinii PBi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap