Conserved Protein Domain Family
BluB

?
TIGR02476: BluB 
5,6-dimethylbenzimidazole synthase
A previously published hypothesis that BluB, involved in cobalamin biosynthesis, is EC 1.16.8.1 (cob(II)yrinic acid a,c-diamide reductase) is now contradicted by newer work ascribing a role in 5,6-dimethylbenzimidazole (DMB) biosynthesis. The BluB protein is related to the nitroreductase family (pfam0881). [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 162875
View PSSM: TIGR02476
Aligned: 7 rows
Threshold Bit Score: 295.503
Threshold Setting Gi: 46197938
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB76073      642 YDDAERAAVLKVMRERRDIRNGFrSDPIPHEVLLRVLEAAHTAPSVGHSQPWDFVVIRSADTRRAMHELATRQRDAYAKS 721  Streptomyces ...
tigr:BMA2051    3 FDEPAIAAVYRAIFERRDMRHFT-SAPVDPAVLARLLRAAHHAPSVGFMQPWRFIRVTDPALREQIHALVDAERRATADA 81   Burkholderia ...
AAS82348       11 FSEAEKAAVYRALLTRRDIRHFR-PDPIPEEVLERLYQAFHAAPSVGLTQPWAIVEIRERATKERVFALHQEARTRERAL 89   Thermus therm...
WP_002965598    3 FSSSERETFFELIKWRRDVRHFR-RDPVPEDMVQALKTAMDHAPSVGNARPWRIFSVESQAKRKAVHHIFTEANQAAAQI 81   Brucella
WP_006316679   26 FSGAEREAIYRAIETRRDVRDQFlPDPLPEELVERLLKAAHSAPSVGFMQPWNFTLVTDGGVRQAAWVAFSRANEEAAAM 105  Agrobacterium...
WP_003598585   15 FDDAFRARLADLFAWRRDVRRFS-REPVDEAALRTCLDLAALAPSVGNSQPWRFVRVSEPRRRAAVIASFERCNAAACAT 93   Methylobacter...
WP_011048944    6 FSDDFRTQFDLLMRLRRDVRRFR-TDPVDEAVLTRCLDTFRLAPSVGLSEPWRVIRVESDAARAAALENYQSANGEALKG 84   Ruegeria pome...
CAB76073      722 LPKgRAKQFKELKIEAILDTPVNIVVTADPTRgGRHTLGRHTQPQMAPYSSALAVENLWLAARAEGLGVGWVSFFDEREM 801  Streptomyces ...
tigr:BMA2051   82 LGE-RHDEFMRLKVEGVRECGELLVVALADGR-ERHVFGRRTLPEMDLASAACAIQNMWLAARAEGLGMGWVSLFDVDAL 159  Burkholderia ...
AAS82348       90 FQGkAQRVYDRLRLEGLLEAPLHLAVFQ---RpVARSLGHHTMPETLAYSVVLAVGNLWTAARPEGIGVGWVSILEPEAV 166  Thermus therm...
WP_002965598   82 YDGaRASQYHALKLEGIETAPVQLAVFTDTAPaEGHGLGRQSMASTLEQSTAMAVQNLNLAARSFGLGAGMVSVLDPQAM 161  Brucella
WP_006316679  106 FEGeKQALYRSLKLEGIRKAPLSICVTCDPTRgGKVVLGRTHNPRTDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDV 185  Agrobacterium...
WP_003598585   94 YADeQRTLYARLKLAGLREAPVHLAVFCDSGTgAGHGLGRATMPEMLRYSVAACIHAFWLAARAHGIGVGWVSILEPTVV 173  Methylobacter...
WP_011048944   85 YSGeRAQQYSQLKLSGMQEAPVQLAVFCDDATaKGHGLGAGTMPEMRRYSVVSAITLFWLMLRAEGLGLGWVSILDPDRL 164  Ruegeria pome...
CAB76073      802 VRALGLPEHLDVVAYLCVGYVDEFPDEPELMQAGWSKRRPLSWVVH 847  Streptomyces coelicolor A3(2)
tigr:BMA2051  160 RRLLAMPDGATPIAVLCLGHVDAFYAKPMLEQERWATRMPLEACLY 205  Burkholderia mallei ATCC 23344
AAS82348      167 ARLLGAPPDYRLLAYLCLGYPRAWPDEPLLERAGWRQREPL--LRY 210  Thermus thermophilus HB27
WP_002965598  162 EQLFEVPPSWRFTLYLCIGWPCTEDDTPLLHRNGWQENRETFWRRA 207  Brucella
WP_006316679  186 RAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGWRQRVPLEELVF 231  Agrobacterium sp. ATCC 31749
WP_003598585  174 TDALDVPEGWDLVAYLCVGHPVEEHADPELVRHGWQERHPEAARLH 219  Methylobacterium extorquens
WP_011048944  165 CRDLRAPETWRLIGYFCIGWPQECSDIPELETAGWEVRDRRLTVEI 210  Ruegeria pomeroyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap