Conserved Protein Domain Family
flagell_FliJ

?
TIGR02473: flagell_FliJ 
flagellar export protein FliJ
Members of this family are the FliJ protein found, in nearly every case, in the midst of other flagellar biosynthesis genes in bacgterial genomes. Typically the fliJ gene is found adjacent to the gene for the flagellum-specific ATPase FliI. Sequence scoring in the gray zone between trusted and noise cutoffs include both probable FliJ proteins and components of bacterial type III secretion systems.
Statistics
?
PSSM-Id: 131526
View PSSM: TIGR02473
Aligned: 24 rows
Threshold Bit Score: 50.3914
Threshold Setting Gi: 34104305
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE78198       4 KFPLQKVLEHRKIKENLAQKDFQEAVNLYQEELARLNQMGNQVQSAHAQVGALSNQGgAQGPALSQIHEFLQGQQIRIQR 83  Bdellovibrio ba...
CAE33077       4 QLPLDMLIGLAKDSTDEAARELGRLSAERNNAEQQLNMLQDYRQDYLQRMQTAMQSG-MSAADCHNYQRFIATLDDAIGQ 82  Bordetella bron...
CAE14237       4 QSPLITLRDLAQNAVEKAATHLAQVCQNYQQMEQQLATLMGYQDEYRERLNDTLSHG-MPCTTWQNYQQFMKTLEKAIEQ 82  Photorhabdus lu...
AAQ60664       5 IRQLDLLLRLRERDGERLETELAAK----RRLQERYRRNIERLDQLSAASGPSAAAG-HPALALN-CAGYKRHLLDLRQS 78  Chromobacterium...
AAS63205       5 IDTLQQLQQLRQRSLNQVTSQLTQQ----KQLCQRYQRNINALNALTLS--EEAFPG-VSALQMANHAGYQRHIQRLIDW 77  Yersinia pestis...
CAD85998       4 PHSLKLLLDHARKQTDDAAINLGKLNLKQQEAEKTLQLLVEYRENYQSQFMESAGSG-ISPVEWRNFKAFICKLDTAIQS 82  Nitrosomonas eu...
BAC60508       2 NNAMEFLLEQTKEREDQAVLALNKARSELEDYYRQVEQIEKYRLDYCQQLVDRGQAG-LTASQYGHLNRFLCQLDETLSK 80  Vibrio parahaem...
AAN56223       4 TDPLLLVLKLALDAEEQAALLLKSAQLECQKRQNQLDALNNYRLDYMKQMQSQQGQA-ISASHYHQFHRFIRQIDEAIAQ 82  Shewanella onei...
AAM41211       4 SKRIDPLLRRAQEQEDKVARDLAERQRALDTHQSRLEELRRYAEEYASS----QMSG-TSAVALSNRRAFLDRLDSAVLQ 78  Xanthomonas cam...
WP_011333052   6 aaRLAPVVDMAEKAEKTAVQRLGYFQGQVKVAESKLADLNAFRLDYSQQWIVRGSTG-VTGQWLLGFQGFLAQLDTAVDQ 84  Pseudomonas flu...
CAE78198      84 QMQKVQEFEKLVEAKREILRQAALEYKIMEKMRENKFEEYRAERLSNDQKEMDEQSILRFKA 145 Bdellovibrio bacteriovorus HD100
CAE33077      83 QRHVLHRAEAHLNDGRLNWQQQKRKLNSFDTLAQRESRTQALLEARREQRANDEYSARLVRR 144 Bordetella bronchiseptica RB50
CAE14237      83 HKLQLNQWQQRLDTALSQWREKQQRLNAFDTLQQRADNNRRLHQNRTEQKQMDEYAQRSVQR 144 Photorhabdus luminescens subsp. l...
AAQ60664      79 QQQDLQLAQADAEVSQSRLQDARRREEQVKLLREEKLLEWRTAQSRAEQKRTDEAAGQAWMR 140 Chromobacterium violaceum ATCC 12472
AAS63205      78 QKQEQALADIEVGNLQTQMQQQARREKIVAVVLEQQQEEYQREQGRLAQKNTDALATQCWQR 139 Yersinia pestis biovar Microtus s...
CAD85998      83 QQRLVTMTQQHTEAGSTQYHAHRQKLKSYDTLSQRAELHHQARLQKQEQRQLDEHTAHNFSK 144 Nitrosomonas europaea ATCC 19718
BAC60508      81 QKQAEHHFKEQVENCKDYWLKMRQERMSYEWMIEKKAKEKQIAEAKREQKQMDEFSTLLFSR 142 Vibrio parahaemolyticus RIMD 2210633
AAN56223      83 QQRVVADGEKQKNYRQHYWLEKQKKRKAVELLLDNKEKKRQAIELKKEQKMTDEFASQQFYR 144 Shewanella oneidensis MR-1
AAM41211      79 QAQTVESNRAKVEAERTRLLLASREKQVLEQLAASYRAQENKVIERRDQREMDDLGARRVRL 140 Xanthomonas campestris pv. campes...
WP_011333052  85 QRQSLQWHQNNLDKARDAWQQAFARVEGLRKLVQRYRDEAQRAEDKREQKLLDELSQRLPRH 146 Pseudomonas fluorescens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap