Conserved Protein Domain Family
sucr_P_syn_N

?
TIGR02472: sucr_P_syn_N 
sucrose-phosphate synthase, putative, glycosyltransferase domain
This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (TIGR02471), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant SPS. At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase.
Statistics
?
PSSM-Id: 131525
View PSSM: TIGR02472
Aligned: 6 rows
Threshold Bit Score: 810.879
Threshold Setting Gi: 16605569
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC08134       5 LYIVLISIHGLIRGDRLELGRDADTGGQTRYVVELAKTLAAHPRVAQVDLVTRLIPDAKVSPDYAQPIERIGDRARIVRL 84  Thermosynechoco...
CAD85124       7 LYILMMSVHGLVRGHDMELGRDADTGGQITYVVELARALGRNSHIAQIDLLTRQIEDPNISPDYAAEIEELGPNARIVRL 86  Nitrosomonas eu...
CAD78343       9 LRVTLLSLHGLIRARDCELGRDADTGGQVKYVLELAEELSRREEVESVELVTRQIFDERVGPDYAQVEEIINPKAKIVRV 88  Rhodopirellula ...
CAC87822       3 LRLLHLHLHGLFRSHDLELGRDADTGGQALYVLELVRGLAARSEIEQVEVVTRLIHDRRVSTDYANPIEDIAPGAKIIRL 82  Prochlorococcus...
CAC87821       3 LKFLYLHLHGLIRSNNLELGRDSDTGGQTQYVLELVKSLANTSEVDQVDIVTRLIKDSKIDSSYSKKQEFIAPGARILRF 82  Prochlorococcus...
WP_011715057   8 LYLILISPHGLIRGENLELGRDADTGGQTKYVVELARALAQRPEVGRVDLLTRRVVDAQLSSDYAEPVERLSDKARIVRI 87  Magnetococcus m...
BAC08134      85 ACGPRRYLRKEVLWPYLDVFADELLRYLRQSGRMPDVIHSHYADAGYVGCRVAGWLGVPLVHTGHSLGRVKRQRLLAQGS 164 Thermosynechoco...
CAD85124      87 PCGPRKYLRKELLWPHLDQMVDRCLHYLRQQGRLPDLIHTHYADAGYVGQHLSNLLGIPQIHTGHSLGRPKRARLLASGR 166 Nitrosomonas eu...
CAD78343      89 PFGPKRYLRKEGLWPYLETFIDQMLGHYRRVG-LPDLIHGHYADAGYAGAQLARLLHVPYVFTGHSLGRVKRQRLIAASQ 167 Rhodopirellula ...
CAC87822      83 PFGPRRYLRKELFWPYLDDLADQTVSHLQQQEHLPDWIHAHYADAGYVGALVSRRLGVPLVFTGHSLGREKLRRLLGVGG 162 Prochlorococcus...
CAC87821      83 QFGPNKYLRKELFWPYLDELTQNLIQHYQKYENKPSFIHAHYADAGYVGVRLSQALKVPFIFTGHSLGREKKRKLLEAGL 162 Prochlorococcus...
WP_011715057  88 ECGGLAYLPKEQLWDSLDNYADNALAYIHEQPHMPHLIHTHYADAGYVGAHLCSMLEIPLIHTGHSLGRSKRKRLLAGGL 167 Magnetococcus m...
BAC08134     165 K------PDAIEEQFHLTTRIEAEEQTLASAALIIASTHQEVEEQYRLYDQYDPARMAVIPPGVDTSRFYP-APVPADLP 237 Thermosynechoco...
CAD85124     167 K------EQAIERQFNLSRRIAAEEEVLVHASLIITSTSQEIEDQYGMYKNTDPRRCQVIPPGTDTSRFSPpGRKPLDPA 240 Nitrosomonas eu...
CAD78343     168 EskapkpPRELDKKFKFTVREEAEEFALETASMVITSTGQEVEEQYAVYDHYQPDRMEVIPPGVDLDQFYPvDESEPLPR 247 Rhodopirellula ...
CAC87822     163 D------HEQIEQTYAIGQRIDAEEFTLAHCSLVITSTRQEIDHQYARYGRFVPEQAEVVPPGVDSIRFHPlQSSSETDV 236 Prochlorococcus...
CAC87821     163 K------INQIEKLYCISERINAEEESLKYADIVVTSTKQESVSQYSQYHSFSSEKSKVIAPGVDHTKFHHiHSTTETSE 236 Prochlorococcus...
WP_011715057 168 A------RQEIEAIYNISRRIDAEERTLAAASSVVVSTHQEIQGQYVLYDYYQPDQMQVIPPGTDLNKFYApQGDEAQSD 241 Magnetococcus m...
BAC08134     238 FRQELRRFLVEPEKPFIFCLSRPVPRKNVAALLNVYGSDRFLQARANLVLVLGNRTDISKMEASPRQVLMELFLLVDRYD 317 Thermosynechoco...
CAD85124     241 IQAGIDRFLNTPEKPVILTICRPDTRKNLHGLIQAYGSDPSLQDMANLVIIAGSREDIRAMEESQRKIMNDVLLDIDRYD 320 Nitrosomonas eu...
CAD78343     248 IHDLLTPFLKDSEKPMVVAMARPDERKNIEMLVRVFGENPKFREMANLVLVLGSRDDLREMPSGQRRVLTNVLHLIDVYD 327 Rhodopirellula ...
CAC87822     237 VDGLLAPFLRKPSLPPLLAISRAVRRKNIPFLVEAYGRSPVLRQRHNLVLVLGCRDDPRQLEKQQREVFQQVFDLVDRYD 316 Prochlorococcus...
CAC87821     237 IDNMMIPFLKDIRKPPILAISRAVRRKNIPSLVEAYGRSEKLKRKTNLVLVLGCRDNTFKLDSQQRDVFQKIFEMIDKYN 316 Prochlorococcus...
WP_011715057 242 IAKQLARFLTHPDKPIILALSRPDPRKNITTLVEAYGQSPQLQEMANLVIIAGNRDDIRDMDAGAQEVLTSLLMTMDLYD 321 Magnetococcus m...
BAC08134     318 LYGKVAYPKTHRSDEVPDLYRLAAQQRGVFINPALTEPFGLTLIEAAACGLPILATADGGPQEIIRHCRNGLLFDALDLE 397 Thermosynechoco...
CAD85124     321 LWGKIAIPKHFMVEDVPEVYRLAVRRRGIFVNSALTEPFGLTLIEAAASGLPIIAPEDGGPRDIITNCRNGLLVNTLNPS 400 Nitrosomonas eu...
CAD78343     328 LYGHVAYPKAHRPSDVPELYRLTARRKGIFVNPALTEPFGLTLLEAAASGVPIVATNDGGPRDIIANCQNGLLIDPLSAE 407 Rhodopirellula ...
CAC87822     317 LYGRVAYPKQHRRDQIPAIYRWAALHRGLFVNPALTEPFGLTLLEAAACGLPMVATDDGGPRDILARCDNGLLVDVTDLE 396 Prochlorococcus...
CAC87821     317 LYGKVAYPKKHSPANIPSIYRWAASSGGIFVNPALTEPFGLTLLEASSCGLPIIATDDGGPNEIHAKCENGLLVNVTDIN 396 Prochlorococcus...
WP_011715057 322 LYGKMAMPKHHQADDVPQLYRLAALSKGVFVNPALIEPFGLTLIEAAACGLPLVATEDGGPIDIVSNCKNGLLIDPLDGE 401 Magnetococcus m...
BAC08134     398 AIRSALHQAFQSDSQWQTWADNGLKGVQAHYSWHSHVEMYLQALD 442 Thermosynechococcus elongatus BP-1
CAD85124     401 DIASALKDALSDRKRWRNWSRNGIASVRRHYTWDAHVSKYLREAD 445 Nitrosomonas europaea ATCC 19718
CAD78343     408 DIDHALMRCLTEPEQWQTWSENGIEGSRTHYSWANHVDRYLRDVT 452 Rhodopirellula baltica SH 1
CAC87822     397 ALQDVMEQAGSDADQWRLWSDNGIVAVSRHFSWDAHVCHYLALMK 441 Prochlorococcus marinus
CAC87821     397 QLKIALEKGISNSSQWKLWSRNGIEGVHRHFSWNTHVRNYLSILQ 441 Prochlorococcus marinus
WP_011715057 402 AIAQALMDILSDQGQWQRFAQAGQQGVRAHYSWQAHVEKYLAMIQ 446 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap