1S9A


Conserved Protein Domain Family
chlorocat_1_2

?
TIGR02465: chlorocat_1_2 
Click on image for an interactive view with Cn3D
chlorocatechol 1,2-dioxygenase
Members of this protein family are chlorocatechol 1,2-dioxygenase. This protein is closely related to catechol 1,2-dioxygenase, TIGR02439, EC 1.13.11.1. Note that annotated database entries have appeared for the present protein family with the EC number that refers to that of family TIGR02439. This protein acts in pathways of the biodegradation of chlorinated aromatic compounds.
Statistics
?
PSSM-Id: 131518
View PSSM: TIGR02465
Aligned: 5 rows
Threshold Bit Score: 418.019
Threshold Setting Gi: 49258915
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S9A_A     3 NTRVIELFDEFTDLIRDFIVRHEITTPEYETIMQYMISVGEAGEWPLWLDAFFETTVDSVSYGKgNWTSSAIQGPFFKEG 82  Rhodococcus opacus
CAD60254   2 SNRTKDITLDIVEAVRDVLRRHEVTFDEYRAGFQHLAKTQGAGEIPLLIDVFFNSTIVEIENEKrRGSHACIQGPYFVQN 81  Aquamicrobium lusat...
P11451     2 DKRVAEVAGAIVEAVRKILLDKRVTEAEYRAGVDYLTEVAQTRETALLLDVFLNSTIIEGKAQRsRTSAPAIQGPYFLEG 81  Pseudomonas putida
P05403     2 NKRVKDVVDAIVAAVQRVLDQKEVTEAEYRTAVHYLMQVAEQRETALLCDVFFNSTVAATKARisEGSTPAIEGPYYRDD 81  Cupriavidus necator
CAF32818   2 SNRLEAVVADIVEGIRGALMKHDVTFDEYRQGIGYIMKTVEAGELPLMIDAFLNTTICQIENRNfGGSTSTLEGPYFLDD 81  Sphingobium herbici...
1S9A_A    83 APLLTgkpATLPMRA-DEPGDrMRFTGSVRDTSGTPITGAVIDVWHSTNDGNYSFFSPALPDqYLLRGRVVPAEDGSIEF 161 Rhodococcus opacus
CAD60254  82 APNVA---ETLAIRDqDAGHPkMVMRGKVTGLNGQPVAGAVIDVWHATPDGKYSGIHDNIPP-QYYRGKITTAADGSYEC 157 Aquamicrobium lusat...
P11451    82 APVVE---GVLKTYDtDDHKP-LIIRGTVRSDTGELLAGAVIDVWHSTPDGLYSGIHDNIPV-DYYRGKLVTDSQGNYRV 156 Pseudomonas putida
P05403    82 APLVD---DRLKTYDtDDHKP-LLIQGTVKAVDGSVVEDVTIDVWHSTPDGKYSGFHDDIPT-DFYRGKLRVGTDGSFRV 156 Cupriavidus necator
CAF32818  82 APFVE---GALKTYEdDRHEP-LLLRGRVLDLAGAPVADAIIDVWHSTPDGHYGGFHNNIPR-DFYRGKLRTDAAGGYEV 156 Sphingobium herbici...
1S9A_A   162 HSIRPVPYEIPKAGPTGQLMNSyLGRHSWRPAHIHIRITADGYRPLITQLYFEGDPYLDSDSCSAVKSELVLpvnKIDID 241 Rhodococcus opacus
CAD60254 158 RSILPVPYQIPNAGPTGELLETyMQWHSWRPAHIHYWIHADGMRDLISQAYFEGDQYIDDDCCNGGGSEFMV---PEVYE 234 Aquamicrobium lusat...
P11451   157 RTTMPVPYQIPYEGPTGRLLGH-LGSHTWRPAHVHFKVRKDGFEPLTTQYYFEGGKWVDDDCCHGVTPDLIT---PETIE 232 Pseudomonas putida
P05403   157 RTTMPVPYQIPDQGPTGALLET-MGGHSWRPAHVHFKVKAPGYETLTTQYYFEGGDWITDDCCNGVQSSLIT---PDIVE 232 Cupriavidus necator
CAF32818 157 RTTVPVAYKIPDQGPVGALLEA-MGRHSWRPAHVHYKVRAPGFHTLTTQAYFEGGEYVDSDCCEGVHSELIH---ADVRE 232 Sphingobium herbici...
1S9A_A   242 GEtWQLVDFNFILQHN 257 Rhodococcus opacus
CAD60254 235 GD-VRVMEVNFTLDPR 249 Aquamicrobium lusatiense
P11451   233 DG-VRVMTLDFVIERE 247 Pseudomonas putida
P05403   233 EG-VRLMNINFVIEPA 247 Cupriavidus necator
CAF32818 233 SG-IKVIETDFELAPA 247 Sphingobium herbicidovorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap