1XVI


Conserved Protein Domain Family
MPGP_rel

?
TIGR02463: MPGP_rel 
Click on image for an interactive view with Cn3D
mannosyl-3-phosphoglycerate phosphatase-related protein
This family consists of members of the HAD superfamily, subfamily IIB. All members are closely related to mannosyl-3-phosphoglycerate phosphatase, the second enzyme in a two-step pathway for biosynthesis of mannosylglycerate, a compatible solute present in some thermophiles and in Dehalococcoides ethenogenes. However, members of this family are separable in a neighbor-joining tree constructed from a multiple sequence alignment and are found only in mesophiles that lack the companion mannosyl-3-phosphoglycerate synthase (TIGR02460). Members of this family are like to act on a compound related to yet distinct from mannosyl-3-phosphoglycerate. [Unknown function, General]
Statistics
?
PSSM-Id: 131516
View PSSM: TIGR02463
Aligned: 7 rows
Threshold Bit Score: 330.958
Threshold Setting Gi: 33639565
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XVI_A    11 LVFSDLDGTLLDsHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKTLGLQgLPLIAENGAVIQLAEQWQEIDgf 90  Escherichia coli K-12
AAP99773  11 WIVTDIDGTLMD-HQYDFSPALSTIKWLQELGIPIIPCTSKTAAEVRALRLELGIT-DPFIVENGGAIYGDELSSNEE-- 86  Prochlorococcus mar...
CAE19419   8 WVVSDVDGTLMD-HSYDLTPAKETIKLLQELSIPVILCTSKTAAEVKVIRKELNLT-DPYIVENGAAIHGETLKR-VN-- 82  Prochlorococcus mar...
CAE08949  10 WVVTDLDGTLMD-HHYDWAPAAAVLRSLQRAGVPVIPCTSKTAEEVERFRAAAQLR-DPYIVENGGAIHGETATG-EP-- 84  Synechococcus sp. W...
Q8XGE1     9 LIFTDLDGTLLNsHTFEWQPAAPWLTRLHESGVPVILCSSKTAAEMLQLQTTLNLQgLPLIAENGAVIQLDVHWEDHPny 88  Salmonella typhimurium
CAG75151   9 IIFSDLDGSLLDhETYRWDAAQRWLTRLANEAIPLIITTSKTAAEVEPLQQALGLDdYPYIAENGAIAVLPPTWRTHPey 88  Pectobacterium atro...
P76329     9 LVFSDLDGTLLDsHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKTLGLQgLPLIAENGAVIQLAEQWQEIDgf 88  Escherichia coli K-12
1XVI_A    91 PRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWrDSDERMAQFTARLNEL 170 Escherichia coli K-12
AAP99773  87 WELVLGKSYKYLRSKLELISLELGYKLIPLNDLSYQEINELTGLEGRGIELALDRKWSVPFLN-PKDSDRERITEIASSL 165 Prochlorococcus mar...
CAE19419  83 GEIILGEKYEILENILISISNEINYNLQPLNNISDQEATELTGLKGHSLDLMRDRHWSMPFLN-PPENKEEEINICCKRF 161 Prochlorococcus mar...
CAE08949  85 WQEALGPGWTVLKPRLQELSEQLSEPLRALDELTDAEGERLLGLSGELLQQAQRRRCSVPFVP-PSVAIQPRLDALSAAQ 163 Synechococcus sp. W...
Q8XGE1    89 PRLIAGISHNEIRLVLHKLREKEQFKFTTFDDVDDQVISEWTGLNRAQSALTRLHEASVSLIWrDSDERMAQFVARLNDL 168 Salmonella typhimurium
CAG75151  89 PRKRMGSGYSIIRTQLEQLHASG-FRFKGFGDMSCAEIAEVTGLSEQDARRAQQREASEPLLWlDDASRLPHFRQLLADV 167 Pectobacterium atro...
P76329    89 PRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWrDSDERMAQFTARLNEL 168 Escherichia coli K-12
1XVI_A   171 GLQFMQGARFWHVLDASAGKDQAANWIIATYQQlsgK---RPTTLGLGDGPNDAPLLEVMDYAVIVK 234 Escherichia coli K-12
AAP99773 166 CTSIYKGNRMSHLLGEGSHKGKAVIELKKFLNQ---P---NIKVVALGDSQNDLPLLEVADIAIVIP 226 Prochlorococcus marinus subsp. m...
CAE19419 162 GVEIFRGNRMSHMLSINSNKGKAINALKNYSNN---P---NIKIIGLGDSPNDLPLLLNSDYKIVIP 222 Prochlorococcus marinus subsp. p...
CAE08949 164 GLAVVRGNRMCHLLGAEVSKGNALAALKQRLHE---P---DVKVLALGDSPNDLPLLEVADLAVVVP 224 Synechococcus sp. WH 8102
Q8XGE1   169 GLQFVHGARFWHVLDASAGKDQAANWLIEAYRR---QwraRPLTLGLGDGPNDAPLLDVMDYAVVVK 232 Salmonella typhimurium
CAG75151 168 GLALTQGGRFYHVMGTQTSKGFTGNWIKTQYIE---KygtDVKTLGLGDGPNDLSLLCTVDCAVLIK 231 Pectobacterium atrosepticum SCRI...
P76329   169 GLQFMQGARFWHVLDASAGKDQAANWIIATYQQ---LsgkRPTTLGLGDGPNDAPLLEVMDYAVIVK 232 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap