2ZU7,2WVK


Conserved Protein Domain Family
osmo_MPGsynth

?
TIGR02460: osmo_MPGsynth 
Click on image for an interactive view with Cn3D
mannosyl-3-phosphoglycerate synthase
This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together mannosyl-3-phosphoglycerate phosphatase (MPGP) comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
Statistics
?
PSSM-Id: 162866
View PSSM: TIGR02460
Aligned: 6 rows
Threshold Bit Score: 612.567
Threshold Setting Gi: 28950684
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZU7_A     2 LLEAPVYKEIFGAVTIHEVQKVIKXDTE-T--EEVP----IYTISNIPREKIYDLLGKXAVIVPXKNEKLHLVDGVLKAI 74  Pyrococcus horikoshii
O58689     2 LLEAPVYKEIFGAVTIHEVQKVIKMDTE-T--EEVP----IYTISNIPREKIYDLLGKMAVIVPMKNEKLHLVDGVLKAI 74  Pyrococcus horikosh...
AAO43097   2 RLEIPNHTERFGVVRLHEVQRILELDSGrV--RDESp---AVGLRRLDDADLRDVLEQTAIVVPTRNERLKLLEGVLSGI 76  Thermus thermophilu...
Q9YDM5     2 MLSLPAKFEVFGAVRIYDVSRVLSLDGR----PKSR----PTNLVYVDRGELEDAAFRTVIVVPVKDEDLLTLENVLRSI 73  Aeropyrum pernix K1
CAD42692   3 LDYPPNYTERIGAVSIHALQKIYEIDSGkM--PKFNglhqHQSIKAFGYDELSSIFQELAIVIPVKNEKISLLEGVLSGI 80  uncultured crenarch...
2WVK_A     2 RLEIPNHTERFGVVRLHEVQRILELDSG-RvrDESP----AVGLRRLDDADLRDVLEQTAIVVPTRNERLKLLEGVLSGI 76  Thermus thermophilu...
2ZU7_A    75 PHKCPIIIVSNSKREGPNRYKLEVDLIRHFYNLTHSKIIXIHQKDPGLAKAFKEVGYTDILDENGXIRSGKGEGXLVGLL 154 Pyrococcus horikoshii
O58689    75 PHKCPIIIVSNSKREGPNRYKLEVDLIRHFYNLTHSKIIMIHQKDPGLAKAFKEVGYTDILDENGMIRSGKGEGMLVGLL 154 Pyrococcus horikosh...
AAO43097  77 PHEALILVASNS---SPDRFQMERDLLEEFAHLTERPALIFHQKDPALAEALRAGGYPHPIGEDGLVRSGKAEGMILALV 153 Thermus thermophilu...
Q9YDM5    74 PTESPVVVVSASTREPVDRFSNEVELARLISRSLQRDIAIVYQFDPAWSEALSGTPLESMVGASGRVRKGKGEGMLLGFI 153 Aeropyrum pernix K1
CAD42692  81 PNECLIIIVSNSQRTPVDRFAMEVEMVRQYSSFADKKIMIIHQNDPELANTFKKIKYRSILNTKSQVRSGKAEGMIIGIL 160 uncultured crenarch...
2WVK_A    77 PHEALILVASNS---SPDRFQMERDLLEEFAHLTERPALIFHQKDPALAEALRAGGYPHPIGEDGLVRSGKAEGMILALV 153 Thermus thermophilu...
2ZU7_A   155 LAKAIGAEYVGFVDADNYIPGAVNEYVKDYAAGFLXSESEYTXVRLHWRHKPKVTKG-TLYFKKWGRVSEITNHYLNLLV 233 Pyrococcus horikoshii
O58689   155 LAKAIGAEYVGFVDADNYIPGAVNEYVKDYAAGFLMSESEYTMVRLHWRHKPKVTKG-TLYFKKWGRVSEITNHYLNLLV 233 Pyrococcus horikosh...
AAO43097 154 FAALSGRRYVGFIDADNYFPGAVWEYVRAYAAGFLMAKTPFAMVRILWRYKPKLTEDeGVVFRRYGRVSERNNRALNQLI 233 Thermus thermophilu...
Q9YDM5   154 VAAALGADFVGYVDSDNYVPGSALEYSWIYYSALSRATSSYSMVRIVWPYKGKLAAS-DMYLRKRGRVSTITNGVLNYTL 232 Aeropyrum pernix K1
CAD42692 161 LAKMHLKEYIGFIDSDNYFPGAVNEYVKIFAAGFGMATTPYSNIRISWRSKPKIVNN-SLQFPRWGRISESSNKYLNALI 239 uncultured crenarch...
2WVK_A   154 FAALSGRRYVGFIDADNYFPGAVWEYVRAYAAGFLMAKTPFAMVRILWRYKPKLTEDeGVVFRRYGRVSERNNRALNQLI 233 Thermus thermophilu...
2ZU7_A   234 SEHTAFETTIXVTGNAGEHAXTXKLAEILPFSTGYSIEPYEIVYILERFGKWENVEEfKDVFDQGIEIFQIETLNPHFHE 313 Pyrococcus horikoshii
O58689   234 SEHTAFETTIMVTGNAGEHAMTMKLAEILPFSTGYSIEPYEIVYILERFGKWENVEEfKDVFDQGIEIFQIETLNPHFHE 313 Pyrococcus horikosh...
AAO43097 234 GGVSGFETDVVKTANAGEHAMSLGLALRLPLASGYAVEPQELVSLLELYGGVFPLED-EEVLQHGVEIFQIETRNPHLHE 312 Thermus thermophilu...
Q9YDM5   233 SIYKRIETDIIKTGNSGEQALTVKLGMEMNWGSGFAVETYQLVWMLENCYLGLQAGK-CPIAPDYIEVRQVSPLNPHIHA 311 Aeropyrum pernix K1
CAD42692 240 SHITGFEREIITTGNAGEHALSMSLAENLNYSSGYSVEPYEFINILEKFGGLLPSNN-PDIIEKGIEIFQIETRNPHFHE 318 uncultured crenarch...
2WVK_A   234 GGVSGFETDVVKTANAGEHAMSLGLALRLPLASGYAVEPQELVSLLELYGGVFPLED-EEVLQHGVEIFQIETRNPHLHE 312 Thermus thermophilu...
2ZU7_A   314 DKGKEHVKEXLLLSLATIYHSKLATDNLRKRILKDLRDHGILGENEEP-----PKPLVXRPIKEIPIKEWXDIVE 383 Pyrococcus horikoshii
O58689   314 DKGKEHVKEMLLLSLATIYHSKLATDNLRKRILKDLRDHGILGENEEP-----PKPLVMRPIKEIPIKEWMDIVE 383 Pyrococcus horikoshii OT3
AAO43097 313 NKGDEHIRDMLLACLATVYHSKLATEEVRQSVLEELQAAGALAPGEEP-----PPPVLYPPLSSLDLQAVRKALR 382 Thermus thermophilus HB27
Q9YDM5   312 ERGDEHIAEMTAVSLGTIFHSSLASEEVKSRILDQLKSLGLA---EEP-----PKPSTYRPAGTDPKKVFASFIA 378 Aeropyrum pernix K1
CAD42692 319 EKGNDHLAGMMQESLLAINNSKICNTELTREINDHLLMLQVKHNNDMTklnfkKKHLIMDPIKIIPIDKFAEFVV 393 uncultured crenarchaeote
2WVK_A   313 NKGDEHIRDMLLACLATVYHSKLATEEVRQSVLEELQAAGALAPGEEP-----PPPVLYPPLSSLDLQAVRKALR 382 Thermus thermophilus HB27
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap