Conserved Protein Domain Family
CbtB

?
TIGR02459: CbtB 
cobalt transporter subunit CbtB (proposed)
This model represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of a single trans-membrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a protein (CbtA) predicted to have five additional trans-membrane segments.
Statistics
?
PSSM-Id: 131512
View PSSM: TIGR02459
Aligned: 6 rows
Threshold Bit Score: 65.6158
Threshold Setting Gi: 489436538
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BR1310   4 HMHNS-VSSTLAMPLAARLGTAVVSLLLGAFLIYGVGLAHSDMLHDSAHDTRHSYGFPCH 62  Brucella suis 1330
WP_010910068  6 MNTAS-ISLGTSVSSQSRFMQLALAALLGTFIIGFVGFSHIDAVHNAGHDNRHSMAFPCH 64  Mesorhizobium loti
WP_010971223  1 MSTNLnTANSAVSVKTASVAQSLTAIVLGLFVVGFVGFSHVEAVHNAAHDTRHANAFPCH 60  Agrobacterium fabrum
WP_010961530 30 TSMNAqTSSHSLPVHVGARAAAIAAFALGGLLVLMVGFSPLPAVHDATHDTRHSAGFPCH 89  Methylococcus capsulatus
WP_003606625  1 MTTATlQTQAATTRSAEGARALLVAAFLGLGLVFVAGFAPASVLHNAAHDFRHAQNFPCH 60  Methylobacterium extorquens
WP_003342053  1 MSTISsHAAAPSSTRTQRLTAAISAALLGACLVYFAGFSHIAAVHNAAHDTRHSAAFPCH 60  Pseudomonas syringae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap