Conserved Protein Domain Family
TreS_stutzeri

?
TIGR02455: TreS_stutzeri 
trehalose synthase, Pseudomonas stutzeri type
Trehalose synthase catalyzes a one-step conversion of maltose to trehalose. This is an alternative to the OtsAB and TreYZ pathways. This family includes a characterized example from Pseudomonas stutzeri plus very closely related sequences from other Pseudomonads. Cutoff scores are set to find a more distantly related sequence from Desulfovibrio vulgaris, likely to be functionally equivalent, between trusted and noise limits. [Energy metabolism, Biosynthesis and degradation of polysaccharides, Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 131508
View PSSM: TIGR02455
Aligned: 2 rows
Threshold Bit Score: 1494.47
Threshold Setting Gi: 24984521
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF26837   1 MSIPDNTYIEWLVSQSMLHAARERSRHYAGQARLWQRPYAQARPRDASAIASVWFTAYPAAIITPEGGTVLEALGDDRLW 80  Pseudomonas stutzeri
AAN68526   1 MTQPDPSYVKWLEDRAMLKASQDRASLYSGQSRLWQQPYAEAQPRRATEIASVWLTVYPDAIIAPEGCSVLGALAHEALW 80  Pseudomonas putida ...
AAF26837  81 SALSELGVQGIHNGPMKRSGGLRGREFTPTIDGNFDRISFDIDPSLGTEEQMLQLSRVAAAHNAIVIDDIVPAHTGKGAD 160 Pseudomonas stutzeri
AAN68526  81 KRLSEIGVQGLHTGPIKLSGGIRGRELTPSVDGNFDRISFDIDPLYGSEQELIQMSRMAAAHNAVTIDDLIPSHTGKGAD 160 Pseudomonas putida ...
AAF26837 161 FRLAEMAYGDYPGLYHMVEIREEDWELLPEVPAGRDSVNLLPPVVDRLKEKHYIVGQLQRVIFFEPGIKDTDWSVTGEVT 240 Pseudomonas stutzeri
AAN68526 161 FRLAELAHGPYPGLYHMVEIREEDWALLPEVPAGRDAVNLLPAQCDELKARHYIVGQLQRVIFFEPGVKETDWSATPPIT 240 Pseudomonas putida ...
AAF26837 241 GVDGKVRRWVYLHYFKEGQPSLNWLDPTFAAQQLIIGDALHAIDVTGARVLRLDANGFLGVERRAEGTAWSEGHPLSVTG 320 Pseudomonas stutzeri
AAN68526 241 GVDGKTRRWVYLHYFKEGQPSLNWLDPTFAAQQMIIGDALHALDCLGARGLRLDANGFLGVETRASGTAWSESHPLSLVG 320 Pseudomonas putida ...
AAF26837 321 NQLLAGAIRKAGGFSFQELNLTIDDIAAMSHGGADLSYDFITRPAYHHALLTGDTEFLRMMLREVHAFGIDPASLIHALQ 400 Pseudomonas stutzeri
AAN68526 321 NQLIGGMIRKAGGFSFQELNLTLDDIAQMSKGGADLSYDFITRPAYQHALLTGDTEFLRLMLKEMHAFGIDPASLIHALQ 400 Pseudomonas putida ...
AAF26837 401 NHDELTLELVHFWTLHAYDHYHYKGQTLPGGHLREHIREEMYERLTGEHAPYNLKFVTNGVSCTTASVIAAALNIRDLDA 480 Pseudomonas stutzeri
AAN68526 401 NHDELTVELVHFWTLHAHDMYLYKGQTLPGSILREHIREEIYERLSGEHAPYNLRFVTNGIACTTASLIAAALGIRDLEQ 480 Pseudomonas putida ...
AAF26837 481 IGPAEVEQIQRLHILLVMFNAMQPGVFALSGWDLVGALPLAPEQVEHLMGDGDTRWINRGGYDLADLAPEASVSAEGLPK 560 Pseudomonas stutzeri
AAN68526 481 IGVADIELIKKVHLLLVMYNAMQPGVVALSGWDLVGALPLPAEAVAERMLDGDTRWIHRGGYDLAGLDPQAEASVRGMPR 560 Pseudomonas putida ...
AAF26837 561 ARSLYGSLAEQLQRPGSFACQLKRILSVRQAYDIAASKQILIPDVQAPGLLVMVHELPAGKGVQLTALNFSAEPVSETIC 640 Pseudomonas stutzeri
AAN68526 561 ARALYGSLDRQLDESDSFACKVKKLLAVRQAYGIATSRQVLVPEVSSPGLLVMVHELPAGRGIQITALNFGQDAIAEELL 640 Pseudomonas putida ...
AAF26837 641 LPGVAPGPVVDIIHESVEGDLTDNCELQINLDPYEGLALRVVSAAPPV 688 Pseudomonas stutzeri
AAN68526 641 LTGFTPGPVVDMINETVEGDLTEDGRLMVNLDPYEALCLRIVNSSGHV 688 Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap