Conserved Protein Domain Family
anti_sig_ChrR

?
TIGR02451: anti_sig_ChrR 
anti-sigma factor, putative, ChrR family
The member of this family from Rhodobacter sphaeroides has been shown both to form a complex with sigma(E) and to negatively regulate tetrapyrrole biosynthesis. This protein likely contains (at least) two distinct functional domains; several smaller homologs (excluded by the model) show homology only to the C-terminal, including a motif PxHxHxGxE. [Regulatory functions, Other]
Statistics
?
PSSM-Id: 131504
View PSSM: TIGR02451
Aligned: 7 rows
Threshold Bit Score: 290.875
Threshold Setting Gi: 2506990
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P40685         5 HHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLM----------------EETAPVALSEGSLAS 68  Rhodobacter sph...
CAE25993       5 HHIGDDLLLSYAAGTLDEASSLLVATHLALCPHCRARAAAADALGGEML----------------DALPAAAVTPELWQN 68  Rhodopseudomona...
BAB53728       4 HHPSDETLFRYANGSLESGPRIVVAVHVGACTACAERIAGFEALGGSLL----------------HDIEPEDMEPGALDH 67  Mesorhizobium l...
AAK22632       5 RLPSEERLLAYAAGTLSPPEAVVVATHLALRPETRVWSDLGQAVGGGVL----------------EDLEPSALDAGALDK 68  Caulobacter cre...
BAC95362       3 SHPNNMLLQAYASGEIDAVSGLVVATHLEVCPDCRDLVAQFEGEQAQHFaag-----------kqDEMSAQSLFDAMFDA 71  Vibrio vulnific...
AAN55036       4 HHPHAELLQAHAQGELPLSMSMAVAAHCALCQECQNQIAKLTEQAAKLAfvsssddpvqhnasneIDVVDNDPWQQMLSN 83  Shewanella onei...
WP_000120276   3 YHPNYALLAAYAEGGLDSAHGLAISAHLEICPHCRDLVHEIEAELGELLnqqa---------assVALSDDANWQAMFDS 73  Vibrio cholerae
P40685        69 VMAQLDRQIQRP------APARRADP--RAPAPLADYVGrrlEDVRWRTLGGGVRQAILPT-GgEAIARLLWIPGGQAVP 139 Rhodobacter sph...
CAE25993      69 VLARTQDQPETPpailatALRPRSDI--VIPEPLRSYLGtdlAGLRWTRLAPRVQQITIDIpGcRPRARMLRFEAGTRVL 146 Rhodopseudomona...
BAB53728      68 VMAMIDTGEASRakaapaNRLPRADVgiRLPEVLDDCGi---GPWRWIGPGVRWSRVTLPD-DdSANVMLLKVVAGRKLP 143 Mesorhizobium l...
AAK22632      69 TLALLDQPEPQep----tVRLDKTDP--TLPAPLRGFEl---GPWRWLGPGVRVRDVLGPR-DgDCRVILLKIAPGQSTP 138 Caulobacter cre...
BAC95362      72 IVQS--DVKEDArevyepRYIEVKGKrfVLPQTLCRYAD---LMSEWRSYGGKVFSSQLDFgE-EARVNLMYISEGVQIP 145 Vibrio vulnific...
AAN55036      84 IMALP-ESTMSEpyiessVTVSHRNIryQIPRVFRQHIA---LP--WQQIG-KVSRMRFDIdEkNTRASLLYIEALGEIP 156 Shewanella onei...
WP_000120276  74 IVALPQQAASNTpvkttpVMVTVNGKqiAIPKVLARLVK---PEQQWRSYGGKVFSLPLQSeD-NVRMNLMYISQGVSIP 149 Vibrio cholerae
P40685       140 DHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATDAPLRFNSFLPKLVQPFFRI 213 Rhodobacter sphaeroid...
CAE25993     147 EHGHSGRELTLVLHGSLCDGAAVMRRGDVAETDEGTEHQPQAGPDGDCICLAVTDAPLRFKSRFARLLQPWFGI 220 Rhodopseudomonas palu...
BAB53728     144 EHTHAGYEYTHILKGAFSDARGRYGPGDLDEADDDVQHQPIVDKEGECICIAALEGQMKLSGFFGRLIQPLFGG 217 Mesorhizobium loti MA...
AAK22632     139 LHTHGGVELTCVIEGAYATESGVFEEGDFEEADPSVLHQPRVVSSKPCLCVAALDGQIQLPGRMGKLLAPFVKL 212 Caulobacter crescentu...
BAC95362     146 QHTHKGLETTLVLHGSFSDEDGEYQQGDFMQRDASVKHSPKTKAGEDCLCLTVLTDPLIFTQGVARVFNLFGKG 219 Vibrio vulnificus YJ016
AAN55036     157 QHTHKGFELTLLLSGEFSDSTGNYVVGDFIILDGNTQHSPTTQTG--CLCYTVLDAPLYFTKGISKLLNPIGEL 228 Shewanella oneidensis...
WP_000120276 150 QHTHKGFESTLVLHGGFSDENGHYDVGDFMQHDGQICHSPSTPQDQDCLCLTVLTEPMVFTQGVARIFNLFGKG 223 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap