Conserved Protein Domain Family
TIGR02450

?
TIGR02450: TIGR02450 
tryptophan-rich conserved hypothetical protein
Members of this family are small hypothetical proteins of 60 to 100 residues from Cyanobacteria and some Proteobacteria. Prochlorococcus marinus strains have two members, other species one only. Interestingly, of the eight most conserved residues, four are aromatic and three are invariant tryptophans. It appears all species that encode this protein can synthesize tryptophan de novo.
Statistics
?
PSSM-Id: 131503
View PSSM: TIGR02450
Aligned: 8 rows
Threshold Bit Score: 73.6057
Threshold Setting Gi: 28851577
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC62903      10 LHSKWTATSPKNKEKHFVVTEMElDEDGNVVQCVIEAVMSKREQEMNWQDLKDPELWRQGWK 71  Vibrio parahaemolyticus RIMD 2210633
AAP99825       6 PVKAWTSINPIQGERHFVAINYD-VSNHNLWVNMVSVLDGKLYFRVTFEELNDNSMWLPGWK 66  Prochlorococcus marinus subsp. ma...
CAE19084       1 MEIYWTSNKAINGLRHFVLVNKI-NEQNQINFLMVSVVDVEISLKISNEELLNSGNWSEGWL 61  Prochlorococcus marinus subsp. pa...
AAQ00052       5 PNKAWTSSTSIDGYRHFEVIDYG-GKGEERWVTLVAILDKNIKFNVNWTDLKTYAKWTVGWV 65  Prochlorococcus marinus subsp. ma...
CAE07382       5 PARAWTSQHPVGGYRHFQLVLQG-GRGDQRWVELAAVLAPGFRERVLWSDLEDPHRWVSGWQ 65  Synechococcus sp. WH 8102
BAC90045      13 VGSKWTSAGKIMGWRHFQVFARE-DRKGLVFARLQSVCAVEVNVWVNAKTLKNRDLWEPGWT 73  Gloeobacter violaceus PCC 7421
AAO54654      10 LLSKWTAATPQNREKHFLVTELFkDEEGVVLEVELQAVLTQRSERMPWQVLQQADAWRMGWK 71  Pseudomonas syringae pv. tomato s...
WP_010871854  11 LGSKWTAQQKTWGWRHFQVVNRR-QEGQWVFAEMVASCDPKVRFWLNAQQLKDDLLWRSGWQ 71  Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap