1T82


Conserved Protein Domain Family
yiiD_Cterm

?
TIGR02447: yiiD_Cterm 
Click on image for an interactive view with Cn3D
thioesterase domain, putative
This family consists of a broadly distributed uncharacterized domain found often as a standalone protein. The member from Shewanella oneidensis, PDB|1T82_A (Forouhar, et al., unpublished) is described from crystallography work as a putative thioesterase. About half of the members of this family are fused to an Acetyltransf_1 domain (pfam00583). The function of this protein is unknown.
Statistics
?
PSSM-Id: 131500
View PSSM: TIGR02447
Aligned: 9 rows
Threshold Bit Score: 200.272
Threshold Setting Gi: 21106279
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T82_A        21 TWHSTIPVSEFXQIAPLSFTDGELSVSAPLAPNINLHHTXFAGSIYTIXTLTGWGXVWLQQQLLNVD-GDIVLADAHIRY 99  Shewanella onei...
tigr:CT0459    8 ILDSAIPLTQAMGIVVERYTGRELTIIAPLANNFNHLGTAFGGSLYIACVLSAWGLLYLRLREAGIK-GSIVIRKGNAEY 86  Chlorobium tepi...
CAF23266       2 YLWKHIPISKAMGVTVKEASKLKITLEAPLLNNLNHKKTVFGGSLHAVATLSCWSLLHLNIADIYVQpVQIVIAKSEVNY 81  Candidatus Prot...
AAM35110      74 QQFIAMPLVLSMGIAVDGLHDGALRLRAPLQANVNDKANAFGGSLASLMTLASWGWLTLQLQLAGHH-ADVYVADSQLRY 152 Xanthomonas axo...
CAG21758     163 LWQYQIPISDKMGIKISQYTGYRFEVSALINANLNPSEFMFAGSIFTMATLAGWGFIWMLIKERKLE-ADIVLVDSHIRY 241 Photobacterium ...
CAE12538     164 AWYKHIPLSEKMGVRISQYTGQSFITTMPEAGNQNPHQTIFAGSLFSLATLTGWGLIWLLLQERQLG-GDIILADADIRY 242 Photorhabdus lu...
AAN57364      11 TWHSTIPVSEFMQIAPLSFTDGELSVSAPLAPNINLHHTMFAGSIYTIMTLTGWGMVWLQQQLLNVD-GDIVLADAHIRY 89  Shewanella onei...
WP_010999737   9 YLHQNIPISQQMAVSVVSIDEKGVILAAPLLPNINHHGTVFGGSISNLAILSAWTLVYVRLQELFIN-SRIVIRRNTVDY 87  Nostoc sp. PCC ...
AAN65893      11 VLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANVNHKSTMFGGSLYCAAVLVGWGWLHLRLRELGIDdGHIVIQEGQISY 90  Pseudomonas put...
1T82_A       100 LAPVTSAPE-----VKVRWPDTNLSPLQRGRKAKVKLEVQLFCDG--KLCAQFDGLYVSVP 153 Shewanella oneidensis MR-1
tigr:CT0459   87 LRPVTGDIVatgtlPTEEEFAALIESFDRKGKAKMTICAVIEVEG--KVAVKFEGEFAVVR 145 Chlorobium tepidum TLS
CAF23266      82 LLPVSTKFEaecemPDLTKWERFLKTFQRMGKARLSLSAKIMKGE--KTYVDYLGVFVALM 140 Candidatus Protochlamydia amoeboph...
AAM35110     153 VAPVYEDLVanaepSELGSWEAFLATFRQRGKARIGMRAQIALGSg-AAAATLSGRFVAFP 212 Xanthomonas axonopodis pv. citri s...
CAG21758     242 VSPVKERPRa---vVSVETLSGDFDRLAAGRKGRVIVEVNVYSGE--TLASTFTGTYMLFP 297 Photobacterium profundum SS9
CAE12538     243 KKPVIGRPKs---vADLKNMSGDLARLAQGSKARVKLDVIVSGDQ--GIGAVFTGTYMVLP 298 Photorhabdus luminescens subsp. la...
AAN57364      90 LAPVTSAPe-----VKVRWPDTNLSPLQRGRKAKVKLEVQLFCDG--KLCAQFDGLYVSVP 143 Shewanella oneidensis MR-1
WP_010999737  88 FQPLQGDFQahciaPVEDSWSSFVTNLDEKGKGRIILDAEITSSG--ICAAKFQGEYVALI 146 Nostoc sp. PCC 7120
AAN65893      91 PLPVTGTAVarcaaPDEKTWERFLTLYQRRGRARLTLETTVSNDGsdEPAVRFSGQYVLHR 151 Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap