1WDK,3GOA


Conserved Protein Domain Family
fadA

?
TIGR02445: fadA 
Click on image for an interactive view with Cn3D
fatty oxidation complex, beta subunit FadA
This subunit of the FadBA complex has acetyl-CoA C-acyltransferase (EC 2.3.1.16) activity, and is also known as beta-ketothiolase and fatty oxidation complex, beta subunit. This protein is almost always located adjacent to FadB (TIGR02437). The FadBA complex is the major complex active for beta-oxidation of fatty acids in E. coli. [Fatty acid and phospholipid metabolism, Degradation]
Statistics
?
PSSM-Id: 131498
View PSSM: TIGR02445
Aligned: 5 rows
Threshold Bit Score: 706.321
Threshold Setting Gi: 226192787
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WDK_C           6 DVVIVDFGRTPMGRSKGGMHRNTRAEDMSAHLISKVLERNSKVDPGEVEDVIWGCVNQTLEQGWNIARMASLMTQIPHTS 85  Pseudomonas f...
P21151           3 QVVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPALEAAALDDIYWGCVQQTLEQGFNIARNAALLAEVPHSV 82  Escherichia c...
AAO56991         7 DVVIVDFGRTPMGRSKGGMHRNTRAEDMSAHLISKLLERNNKVDPAEVEDVIWGCVNQTLEQGWNIARMASLLTQIPHTS 86  Pseudomonas s...
CMCP6:VV1_0982   3 NVVIVDCLRTPMGRSKGGAFRHTRAEDLSAHLMKGILARNPQVNPSEIEDIYWGCVQQTLEQGFNVARNAALLAGLPIEI 82  Vibrio vulnif...
3GOA_A           3 QVVIVDAIRTPXGRSKGGAFRNVRAEDLSAHLXRSLLARNPSLTAATLDDIYWGCVQQTLEQGFNIARNAALLAEIPHSV 82  Salmonella en...
1WDK_C          86 AAQTVSRLCGSSMSALHTAAQAIMTGNGDVFVVGGVEHMGHVSMMHGVDPNPHMSLYAAKASGMMGLTAEMLGKMHGISR 165 Pseudomonas f...
P21151          83 PAVTVNRLCGSSMQALHDAARMIMTGDAQACLVGGVEHMGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLARMHGISR 162 Escherichia c...
AAO56991        87 AAQTVSRLCGSSMSALHTAAQAIMTNNGDVFVIGGVEHMGHVSMMHGVDPNPHMSLHAAKASGMMGLTAEMLGKMHGITR 166 Pseudomonas s...
CMCP6:VV1_0982  83 GAVTVNRLCGSSMQALHDGARAIMTGDAEICLIGGVEHMGHVPMNHGVDFHPGMSKHVAKAAGMMGLTAEMLGKLHGISR 162 Vibrio vulnif...
3GOA_A          83 PAVTVNRLCGSSXQALHDAARXIXTGDAQVCLVGGVEHXGHVPXSHGVDFHPGLSRNVAKAAGXXGLTAEXLSRLHGISR 162 Salmonella en...
1WDK_C         166 EQQDAFAVRSHQLAHKATVEGKFKDEIIPMQGYDENGFLKIFDYDETIRPDTTLESLAALKPAFNPKGGTVTAGTSSQIT 245 Pseudomonas f...
P21151         163 EMQDAFAARSHARAWAATQSAAFKNEIIPTGGHDADGVLKQFNYDEVIRPETTVEALATLRPAFDPVNGMVTAGTSSALS 242 Escherichia c...
AAO56991       167 EQQDAFGLRSHQLAHKATLEGKFKDEIIPMQGYDENGFLRVFDYDETIRPDTTLESLAALKPAFNPKGGTVTAGTSSQIT 246 Pseudomonas s...
CMCP6:VV1_0982 163 EQQDEFAARSHARAHAATMEGRFKNEILPTEGHAADGTLFTLDHDEVIRPETTVEGLSQLRPVFDPANGTVTAGTSSALS 242 Vibrio vulnif...
3GOA_A         163 EXQDQFAARSHARAWAATQSGAFKTEIIPTGGHDADGVLKQFNYDEVIRPETTVEALSTLRPAFDPVSGTVTAGTSSALS 242 Salmonella en...
1WDK_C         246 DGASCMIVMSAQRAKDLGLEPLAVIRSMAVAGVDPAIMGYGPVPATQKALKRAGLNMADIDFIELNEAFAAQALPVLKDL 325 Pseudomonas f...
P21151         243 DGAAAMLVMSESRAHELGLKPRARVRSMAVVGCDPSIMGYGPVPASKLALKKAGLSASDIGVFEMNEAFAAQILPCIKDL 322 Escherichia c...
AAO56991       247 DGASCMIVMSAQRAQDLGIQPLAVIRSMAVAGVDPAIMGYGPVPATQKALKRAGLSISDIDFFELNEAFAAQALPVLKDL 326 Pseudomonas s...
CMCP6:VV1_0982 243 DGASAMLIMSEEKANELGVTIRARIKGMAIAGCDPSIMGYGPVPATQKALKRAGLSIEDMDVIELNEAFAAQSLPCAKDL 322 Vibrio vulnif...
3GOA_A         243 DGAAAXLVXSESRARELGLKPRARIRSXAVVGCDPSIXGYGPVPASKLALKKAGLSASDIDVFEXNEAFAAQILPCIKDL 322 Salmonella en...
1WDK_C         326 KVLDKMNEKVNLHGGAIALGHPFGCSGARISGTLLNVMKQNGGTFGLSTMCIGLGQGIATVFERV 390 Pseudomonas fragi
P21151         323 GLIEQIDEKINLNGGAIALGHPLGCSGARISTTLLNLMERKDVQFGLATMCIGLGQGIATVFERV 387 Escherichia coli K-12
AAO56991       327 KVLDKMNEKVNLHGGAIALGHPFGCSGARISGTLLNVMKQNGGTFGVSTMCIGLGQGIATVFERV 391 Pseudomonas syringae pv. tom...
CMCP6:VV1_0982 323 GLLDVMDEKVNLNGGAIALGHPLGCSGARISTTLINLMEAKDAKYGLATMCIGLGQGIATVFERP 387 Vibrio vulnificus CMCP6
3GOA_A         323 GLXEQIDEKINLNGGAIALGHPLGCSGARISTTLINLXERKDAQFGLATXCIGLGQGIATVFERV 387 Salmonella enterica subsp. e...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap