Conserved Protein Domain Family
fa_ox_alpha_mit

?
TIGR02441: fa_ox_alpha_mit 
fatty acid oxidation complex, alpha subunit, mitochondrial
Members represent alpha subunit of mitochondrial multifunctional fatty acid degradation enzyme complex. Subunit activities include: enoyl-CoA hydratase (EC 4.2.1.17) & 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35). Some characterization in human (SP:P40939), pig (SP:Q29554), and rat (SP:Q64428). The beta subunit has activity: acetyl-CoA C-acyltransferase (EC 2.3.1.16).
Statistics
?
PSSM-Id: 131494
View PSSM: TIGR02441
Aligned: 4 rows
Threshold Bit Score: 1298.65
Threshold Setting Gi: 17508951
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD55434   38 RLMSTNPAPVANKHLHTKVVNGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGM 117 fruit fly
P40939     27 RNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINM 106 human
AAB94317   34 RNVSTSTALQARTHVSYDIKGDVAVVRFNTPNSKVNTLSKQLNAEFTEVMNEIWTNEAVKSAVLISSKPGSFIAGADIDM 113 chicken
NP_491790  20 RLFSQSAPAMQTTHR-VEKQGDVAVVKIDLPNTKENVLNKALFAEMKATLDKLQSDESIKSIVVMSGKPNSFVAGADIQM 98  Caenorhabditis ele...
AAD55434  118 LEACQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTV 197 fruit fly
P40939    107 LAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLGTPEVLLGALPGAGGTQ 186 human
AAB94317  114 IAACKTSQEVTQLSQEGQKMLEKIEQSPKPIVAAISGSCLGGGLEVAIACHYRIATKDRKTILGTPEVLLGLLPGAGATQ 193 chicken
NP_491790  99 IKAEGTATATETLSREGQEQFFRIEKSQKPVVAAIMGSCMGGGLELALACHYRIAVNDKKTLLSLPEVMLGLLPGAGGTQ 178 Caenorhabditis ele...
AAD55434  198 RLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAVQVANDLASGKLRVNREKsGLV 277 fruit fly
P40939    187 RLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAITFAKGLADKKISPKRDK-GLV 265 human
AAB94317  194 RLPKMVGLPAAFDMMLTGRNINADRAKKMGLVDQLVDPLGPGVKPPEARTIEYLEEVAIGFARGLANKTVSAKRSK-GLV 272 chicken
NP_491790 179 RLPKLTTVQNVLDLTLTGKKIKADKAKKIGIVDRVIQPLGDGLGPAAENTHKYLEEIAVKAAQELANGKLKINRDK-GFM 257 Caenorhabditis ele...
AAD55434  278 SKIQSFVMDTDFVKN-KIFDTARKQVLKASNGLYPAPLKILDVIRAGVDKGTDAGYEAERKGFGELSATPESKGLIALFR 356 fruit fly
P40939    266 EKLTAYAMTIPFVRQ-QVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYH 344 human
AAB94317  273 QRITDYAMALPFVRQ-QVYKTVENKVQKQTKGLYPAPLKIIEVVKAGLDQGHDTGYLTESQSFGHLAMTNESKALIGLYH 351 chicken
NP_491790 258 HKATQAVMTNSLFLDnVVLKMAKDKLMKLTAGNYPAPLKILDVVRTAYVD-PKKGFEAEAKAFGELSQTFQSKALIGLFD 336 Caenorhabditis ele...
AAD55434  357 GQTECKKNRFGKPERPVKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGLETAVKRKRISALERDQ 436 fruit fly
P40939    345 GQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRGQQQVFKGLNDKVKKKALTSFERDS 424 human
AAB94317  352 GQVRCKKNKFGTPQREVKTLAVLGAGLMGAGIAQVSVDKGLKTILKDTTQQGLDRGQQQVFKGLNGKVKKKSLTSFERDS 431 chicken
NP_491790 337 GSTDAKKNKYGKG-LPVNEIAVVGAGLMGAGIANVTIDKGIRTVLLDANPAGVERGQNQIATHLNKQVKRRKINKLEKER 415 Caenorhabditis ele...
AAD55434  437 TLASLRPTLDYSDFKNADIIIEAVFEDIKVKHRVIKELEAVVPEHCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVD 516 fruit fly
P40939    425 IFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYFSPVD 504 human
AAB94317  432 ILSNMTAQLDYKGFEKADMVIEAVFEDISIKHKVLKEVEAVIPPHCIFASNTSALPINQIAAVSQRPEKVIGMHYFSPVD 511 chicken
NP_491790 416 IYNHLVPTIDYSAMKNADVVIEAVFEDLQLKHKVIKQIESVVGPNTIIASNTSALPIKDIAAASSRPDKVIGMHYFSPVE 495 Caenorhabditis ele...
AAD55434  517 KMQLLEIITHPGTSKDTIAQAVAVGLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGVDPKDLDQYTKKFGFPVGA 596 fruit fly
P40939    505 KMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGA 584 human
AAB94317  512 KMQLLEIITTDKTSQDTAASAVAVGLKQGKVVIVVKDGPGFYTTRCLGPMLAEVGRVLQEGIDPKKVDAISTAFGFPVGA 591 chicken
NP_491790 496 KMQLLEIITHDGTSKETLATAAQLGLKQGKLVVVVKDCPGFFVVRCLGPMTAEIMRLLQEGVDPAELDKLTTKFGFPVGA 575 Caenorhabditis ele...
AAD55434  597 ATLADEVGIDVGSHIAVDLAKAFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQKRgTRPVNNDALEIVKQKYALV 676 fruit fly
P40939    585 ATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVK-RKDLNSDMDSILASLKLPP 663 human
AAB94317  592 ATLIDEVGVDVATHVAEDLGKAFGERFGGGSIGLFKLMVQKGFLGRKAGKGFYIYQEGVK-NRSLNSGMDEILAQFKLPA 670 chicken
NP_491790 576 ATLADEVGLDVAEHVAQFLGKALGPRLGGGSADLLSELVKAGHKGRKTGKGIFVYGDGKKgSKKVNDEATKLLQKYKLTP 655 Caenorhabditis ele...
AAD55434  677 SKGANAPEDLTLRMVSRFINEAVLCLEEKILDSPLEGDVGAVFGLGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYG-A 755 fruit fly
P40939    664 KSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYG-K 742 human
AAB94317  671 KPEVCTDEDIQMRLVTRFVNEAAMCLQEGILSNPMEGDIGAVFGLGFPPCLGGPFRYADSYGAKQLVDKLRKYEAVYG-S 749 chicken
NP_491790 656 NASVSSPEDRQIRLVSRFVNEALLCLEEGVLASPSDGDIASVFGVGFPPFWGGPFRFVDLYGADKLVKSMEKFAGAYEaV 735 Caenorhabditis ele...
AAD55434  756 PFKPAQTLLDMAKDPSKKFY 775 fruit fly
P40939    743 QFTPCQLLADHANSPNKKFY 762 human
AAB94317  750 QFTPCQLLLDYANSPGKKFY 769 chicken
NP_491790 736 QFEPCQLLKDHAKS-GKKFY 754 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap