Conserved Protein Domain Family
FadJ

?
TIGR02440: FadJ 
fatty oxidation complex, alpha subunit FadJ
Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Plays a minor role in aerobic beta-oxidation of fatty acids. FadJI complex is necessary for anaerobic growth on short-chain acids with nitrate as an electron acceptor. Activities include: enoyl-CoA hydratase (EC 4.2.1.17),3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadJ (aka YfcX) (SP:P77399). This model excludes the FadB of TIGR02437 equivalog model. [Fatty acid and phospholipid metabolism, Degradation]
Statistics
?
PSSM-Id: 131493
View PSSM: TIGR02440
Aligned: 4 rows
Threshold Bit Score: 1284.76
Threshold Setting Gi: 410519869
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P77399         6 AFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKPDNFIAGADINMIGNCKTAQEAEA 85  Escherichia col...
AAN56095       4 TFNLTRREDGIAILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKKDSFVAGADISMLDACQTAGDAKA 83  Shewanella onei...
CAG19373      13 AFSLTFGDNGVAWLKIDVPNERMNTLQSAFVDQVTDVLAQLKDKKDIKGMVVYSGKPDNFIAGADIRMLAACQTADEAQQ 92  Photobacterium ...
WP_002264659  41 AFTLNVRPDNIGIITIDVVGDKVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARV 120 Yersinia pestis
P77399        86 LARQGQQLMAEIHALPIQVIAAIHGACLGGGLELALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTAL 165 Escherichia col...
AAN56095      84 LSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTAL 163 Shewanella onei...
CAG19373      93 LAAKGQELFGQLEALPFHVVAAIHGPCLGGGLELALACHSRVCSDDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVANAL 172 Photobacterium ...
WP_002264659 121 LAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSKAL 200 Yersinia pestis
P77399       166 EMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRP--LPVRERILAG-PLGRALLFKMVGKKTEHKTQG 242 Escherichia col...
AAN56095     164 DMMLTGKQIRPKQALKMGLVNDVVPQTILLQTAVEMALAGKQIAKPvkKSLVNQLLEGtGFGRNIIFDQAAKQVAKKTQG 243 Shewanella onei...
CAG19373     173 DMILTGKQLRAKKAKNLGLVEEAVPLSILLDIAEKQALKGKPKRK---GSFQEWAMGGnALGRSVVFDQAAKKTHEKTRG 249 Photobacterium ...
WP_002264659 201 DMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGWLNRRA--LPWQERLLSG-PLGKALLFRIVRKKTLAKTRG 277 Yersinia pestis
P77399       243 NYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPGSD-APPAPLNSVGILGGGLMGG 321 Escherichia col...
AAN56095     244 NYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKETGAEgATPRKVKKAVILGGGLMGG 323 Shewanella onei...
CAG19373     250 NYPAADAILDVIKYGLQHGMKKGLDQEAKRFGELVMTSESAALRSIFFATTAMKKESGSD-ALPATIKKVGVLGGGLMGG 328 Photobacterium ...
WP_002264659 278 HYPAAERIIDVVRKGLDQGGPSGYEAEARAFGELAMSPQSAALRSLFFATTSLKKETGSA-ATARAIHRVGVLGGGLMGG 356 Yersinia pestis
P77399       322 GIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKVRRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLE 401 Escherichia col...
AAN56095     324 GIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDKGVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLA 403 Shewanella onei...
CAG19373     329 GISHVTATKAGYPVRIKDISNDGIKNALVYNFKLLDKQRKRRIISKAELQNKMFSITGGTTFTGFTNVDVVIEAVFEDIN 408 Photobacterium ...
WP_002264659 357 GIANVTATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGFERVDIVVEAVFEDLS 436 Yersinia pestis
P77399       402 LKQQMVAEVEQNCAAHTIFASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGT------SAQTIATTVK 475 Escherichia col...
AAN56095     404 LKHQMVKDIERECGEHTIFASNTSSLPIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKT------SPETIATTVA 477 Shewanella onei...
CAG19373     409 LKHQMVKDIEQQTSDYTIFASNTSSLPIHQIAAAAERPENVVGLHYFSPVEKMPLVEVIPHQGTengsatSEQTIATVVA 488 Photobacterium ...
WP_002264659 437 LKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLHYFSPVDKMPLVEVIPHEKT------SEETIATTVA 510 Yersinia pestis
P77399       476 LAKKQGKTPIVVRDKAGFYVNRILAPYINEAIRMLTQGERVEHIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAY 555 Escherichia col...
AAN56095     478 FARKQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDEVGIDVGAKISPILEKEL 557 Shewanella onei...
CAG19373     489 LAKKQGKTPIVVADKAGFYVNRILAPYMNEAAAVLLSGEPIEHIDRSLLDFGFPVGPITLLDEVGVDIGAKISPILLAEL 568 Photobacterium ...
WP_002264659 511 LARKQGKTAIVVADRAGFYVNRILAPYINEAARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQL 590 Yersinia pestis
P77399       556 GERFSAPAnVVSSILNDDRKGRKNGRGFYLYGQKGRk------------------sK---KQVDPAIYPLIGTQGQGRIS 614 Escherichia col...
AAN56095     558 GERFKAPA-AFDKLLSDDRKGRKNGKGFYQYGAASK--------------------K---KAVDETVYGVLGIKPGVDKE 613 Shewanella onei...
CAG19373     569 GERFKAPD-VFDLLLSDDRKGRKSGKGFYLY--NTK--------------------K---KEVDKSVYKLLSLEPEQKAA 622 Photobacterium ...
WP_002264659 591 GPRFAAPP-SFDVILKDGRKGRKNGRGFYLYSNPTKnssptkngnspakrnsfkwrKnkvKPVDASIYTLLGVTPKAHLG 669 Yersinia pestis
P77399       615 APQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLGGPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCER 694 Escherichia col...
AAN56095     614 MSAVAERCVVQMLNEAVRCLDAGIIASPRDGDIGAIFGIGFPPFLGGPFHYIDTLGADNLVKILERYQTQYGDRFEPCQR 693 Shewanella onei...
CAG19373     623 GQDIALRCTLMMLNEAARCLDEGVIKSARDGDIGAIFGIGFPPFLGGPFRYMDTLGAKRVVEMLKDHTDKYGGRFTPCDK 702 Photobacterium ...
WP_002264659 670 AGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYLDSLGADKVVQALRLLVQQYGERFEPCQR 749 Yersinia pestis
P77399       695 LVEMGARGESFW 706 Escherichia coli K-12
AAN56095     694 LKAMAAEKARFF 705 Shewanella oneidensis MR-1
CAG19373     703 LVAMANEEQSFY 714 Photobacterium profundum SS9
WP_002264659 750 LVTMAEQQQQFY 761 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap