1WDK


Conserved Protein Domain Family
FadB

?
TIGR02437: FadB 
Click on image for an interactive view with Cn3D
fatty oxidation complex, alpha subunit FadB
Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Activities include: enoyl-CoA hydratase (EC 4.2.1.17), dodecenoyl-CoA delta-isomerase activity (EC 5.3.3.8), 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadB (SP:P21177). This model excludes the FadJ family represented by SP:P77399. [Fatty acid and phospholipid metabolism, Degradation]
Statistics
?
PSSM-Id: 131490
View PSSM: TIGR02437
Aligned: 5 rows
Threshold Bit Score: 1284.77
Threshold Setting Gi: 51248014
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WDK_A           1 MIYEGKAITVTALESGIVELKFDLKGeSVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEFVENFKL 80  Pseudomonas f...
P21177           1 MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFLV 79  Escherichia c...
AAN53108         1 MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQQSNIQALVLTSGKDTFIVGADITEFLGLFAQ 79  Shewanella on...
P28793           1 MIYEGKAITVTALESGIVELKFDLKGeSVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEFVENFKL 80  Pseudomonas f...
CMCP6:VV1_0981   1 MIYQAETLQVKEVQDGVAEILFCAPN-SVNKLDLATLASLDKALDALTAHSGLKGVMLTSDKEAFIVGADITEFLGLFAK 79  Vibrio vulnif...
1WDK_A          81 PDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIG 160 Pseudomonas f...
P21177          80 PEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLG 159 Escherichia c...
AAN53108        80 DDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIG 159 Shewanella on...
P28793          81 PDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIG 160 Pseudomonas f...
CMCP6:VV1_0981  80 PEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCECVLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIG 159 Vibrio vulnif...
1WDK_A         161 VDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF 240 Pseudomonas f...
P21177         160 ADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM 239 Escherichia c...
AAN53108       160 ADNALEWITTGNEQRAEDALKVGAVDAVVAPEALEVAAIQMLKDAVAEKLDWQARRQRKLSPLTLPKLEAMMSFTTAKGM 239 Shewanella on...
P28793         161 VDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF 240 Pseudomonas f...
CMCP6:VV1_0981 160 ADSAMEIITQGKACRAEEALKIGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGL 239 Vibrio vulnif...
1WDK_A         241 VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSASNCLIGLFLNDQELKKKAKVYDKIAKDVKQ-AAV 319 Pseudomonas f...
P21177         240 VAQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQ-AAV 318 Escherichia c...
AAN53108       240 VFSVAGKHYPAPMAAVNVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQFVKGKAKKAGKLAKAVNS-AAV 318 Shewanella on...
P28793         241 VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSASNCLIGLFLNDQELKKKAKVYDKIAKDVKQ-AAV 319 Pseudomonas f...
CMCP6:VV1_0981 240 VAQVAGPHYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQYIKGIAKKAAKSANKETQrAAV 319 Vibrio vulnif...
1WDK_A         320 LGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKLLVGRVDKGRMTPAKMAEVLNGIRPTLSYGDFGNVDLVVE 399 Pseudomonas f...
P21177         319 LGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVE 398 Escherichia c...
AAN53108       319 LGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLLSAQVARGRSTPEKMAKVLNNITPALEYAPVKHADVVVE 398 Shewanella on...
P28793         320 LGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKLLVGRVDKGRMTPAKMAEVLNGIRPTLSYGDFGNVDLVVE 399 Pseudomonas f...
CMCP6:VV1_0981 320 LGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEASKLLNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVE 399 Vibrio vulnif...
1WDK_A         400 AVVENPKVKQAVLAEVENHVREDAILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDLAVATTV 479 Pseudomonas f...
P21177         399 AVVENPKVKKAVLAETEQKVRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVV 478 Escherichia c...
AAN53108       399 AVVEHPKVKAQVLAEVEQYVSEDAIIASNTSTISISLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVV 478 Shewanella on...
P28793         400 AVVENPKVKQAVLAEVENHVREDAILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDLAVATTV 479 Pseudomonas f...
CMCP6:VV1_0981 400 AVVENPKVKAAVLSEVEEQVSEETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVV 479 Vibrio vulnif...
1WDK_A         480 AYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGPAYLMDVVGIDTGHHGRDVMAE 558 Pseudomonas f...
P21177         479 AWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKqFGWPMGPAYLLDVVGIDTAHHAQAVMAA 558 Escherichia c...
AAN53108       479 AYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKqFGWPMGPAYLLDVVGLDTGHHAQAVMAE 558 Shewanella on...
P28793         480 AYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGPAYLMDVVGIDTGHHGRDVMAE 558 Pseudomonas f...
CMCP6:VV1_0981 480 AYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERkFGWPMGPAYLLDVVGIDTAHHAQAVMAQ 559 Vibrio vulnif...
1WDK_A         559 GFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKKGKQKKLVDSSVLEVLKPIVYEQRDVTDEDIINWMMIPLCLE 638 Pseudomonas f...
P21177         559 GFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKPKKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNE 638 Escherichia c...
AAN53108       559 GFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSRGKPKKDVDPTSYELLKAAFGEQKAFDADEIIARTMIPMIIE 638 Shewanella on...
P28793         559 GFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKKGKQKKLVDSSVLEVLKPIVYEQRDVTDEDIINWMMIPLCLE 638 Pseudomonas f...
CMCP6:VV1_0981 560 GFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKKGKPKKAFSDEIVPILAPVCAAQQAFDDQTIIQRMMIPMINE 639 Vibrio vulnif...
1WDK_A         639 TVRCLEDGIVETAAEADMGLVYGIGFPLFRGGALRYIDSIGVAEFVALADQYAELGALYHPTAKLREMAKNGQSFF 714 Pseudomonas fragi
P21177         639 VVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYY 714 Escherichia coli ...
AAN53108       639 TVRCLEEGIVASPAEADMGLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYY 714 Shewanella oneide...
P28793         639 TVRCLEDGIVETAAEADMGLVYGIGFPLFRGGALRYIDSIGVAEFVALADQYAELGALYHPTAKLREMAKNGQSFF 714 Pseudomonas fragi
CMCP6:VV1_0981 640 VVLCLQEGIIASAQEADMALVYGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAEKGQTFY 715 Vibrio vulnificus...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap