Conserved Protein Domain Family
pcaF

?
TIGR02430: pcaF 
3-oxoadipyl-CoA thiolase
Members of this family are designated beta-ketoadipyl CoA thiolase, an enzyme that acts at the end of pathways for the degradation of protocatechuate (from benzoate and related compounds) and of phenylacetic acid.
Statistics
?
PSSM-Id: 131483
View PSSM: TIGR02430
Aligned: 8 rows
Threshold Bit Score: 646.071
Threshold Setting Gi: 21106443
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM35258   2 NEVYLIDGIRTPIGRYAGALSSVRADDLGAVPIAALLARQSQLEPAAIDDVCLGCANQAGEDNRNVARMSLLLAGLPPSV 81  Xanthomonas axonopo...
AAN39378   3 RHVYICDAIRTPFGRYGGTLSSMRADDLAALPIKALVARNASVDWAAVDDIIYGCANQAGEDNRNVARMAALLAGLPVEV 82  Azoarcus evansii
AAQ61951   2 KNAYICDAVRTPFGRYGGSLSSIRGDELAALPIQALLARNPQLGAASIDDVIYGCANQAGEDNRNVARMAALLAGLPAAV 81  Chromobacterium vio...
Q43974     2 KHAYIVDAIRTPFGRYAGGLAAVRADDLGAIPIAALIERNPSVNWAQVDDVIYGCANQAGEDNRNVGRMSALLAGLPVEV 81  Acinetobacter sp. ADP1
AAL02407   3 REVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQAGEDNRNVARMALLLAGLPDSV 82  Pseudomonas knackmu...
AAK24378   2 TAAYICDGIRTPIGRYGGSLSKVRADDLAAIPLKALVARNPSLDLAAIDEIVLGSANQAGEDNRNVARMALLLAGYPVSV 81  Caulobacter crescen...
P77525     2 REAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAGEDNRNVARMATLLAGLPQSV 81  Escherichia coli K12
CAE12441   3 REVFICDAIRTPIGRYGGVLSKIRADDLGAVPLKYFLQKYQDLDWSAVDEVIYGCANQAGEDNRNVARMSALLAGLPVTV 82  Photorhabdus lumine...
AAM35258  82 PGSTLNRLCGSGLDAIGTVARGIRAGELDLAIAGGVESMSRAPWVMGKADSAFARTQQ-LEDTTMGWRFINPRLQAVYGT 160 Xanthomonas axonopo...
AAN39378  83 PGTTVNRLCGSSLDALGMVARAIASGETELMIAGGVESMSRAPFVLGKADSAFSRSAK-IEDTTIGWRFVNPLMKAQYGI 161 Azoarcus evansii
AAQ61951  82 PGTTVNRLCGSSLDALAMSARALKSGEAELLVAGGVESMSRAPYVVGKADSVFSRSLK-MEDTTMGWRFVNPRMKTLYGV 160 Chromobacterium vio...
Q43974    82 PATTVNRLCGSSLDAIAMAARAIKAGEAHLIIAGGVESMSRAPYVMGKSEGAFGRTQK-IEDTTMGWRFINPKLKAMYGV 160 Acinetobacter sp. ADP1
AAL02407  83 PGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVESMSRAPYVMGKADSAFGRGQK-IEDTTIGWRFINPLMKAQYGV 161 Pseudomonas knackmu...
AAK24378  82 PGVTVNRLCASGLEAVGYAARAIASGHNDLVIAGGVESMSRAPFVMGKADSAFSRSAE-IFDTTIGWRFVNPAMRKLYGV 160 Caulobacter crescen...
P77525    82 SGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMSRAPFVMGKAASAFSRQAE-MFDTTIGWRFVNPLMAQQFGT 160 Escherichia coli K12
CAE12441  83 AATTVNRLCGSGMDAISIGARAIKAGEADLIIAGGVESMSRAPFVMGKAETPFSREANgLHDTTIGWRFINPQMAELYGV 162 Photorhabdus lumine...
AAM35258 161 ELMGETAENVAQRYAIAREDQDAFALRSQQRVAAAQAAGFFDAEIAPVAVAGRKGgDASTVEHDEAPRPNTTAEMLAKLK 240 Xanthomonas axonopo...
AAN39378 162 DSMPETAENVAQEFGVSRADQDAFALRSQQRWSAANERGFFGREILPVEIPRKKG-DPVIFSVDEHPRADTTLEGLAKLK 240 Azoarcus evansii
AAQ61951 161 DTMPETAENVAKEFGVSRSDQDAFALLSQQRTAAAYERGFFADELMEVRIPQRKG-EDKIFAQDEHPR-QTSLEELARLK 238 Chromobacterium vio...
Q43974   161 DTMPQTAENVAEQFGIQREDQDQFAYTSQQRTAAAQAKGYFAKEIVPVTIPQRKG-EPVVIDTDEHPRASTTLEGLAKLK 239 Acinetobacter sp. ADP1
AAL02407 162 DAMPETADNVADDYKVSRADQDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKG--ETVVDADEHLRPDTTLEALAKLK 239 Pseudomonas knackmu...
AAK24378 161 DSMPETAENVATDYGVNREDQDAFALRSQARTAAAQANGFLAGEITPVEIPGKAG--PTIVDRDEHPR-ETTMEALAKLK 237 Caulobacter crescen...
P77525   161 DSMPETAENVAELLKISREDQDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKG-VVTEIQHDEHLRPETTLEQLRGLK 239 Escherichia coli K12
CAE12441 163 DSMPETAENVAETFGISRQDQDLFAFRSQQKAKAAQLSGRFSLEIVSVSVPQKRG-EFLVVDQDEHLRPETTLEGLAKLR 241 Photorhabdus lumine...
AAM35258 241 PVFRQPGTVTAGNASGLNDGAAALLLASAQAVQTHRLTPRARVLGFASAGVEPAYMGIGPVPAAQRLMARLHLRIAQFDA 320 Xanthomonas axonopo...
AAN39378 241 GVVRPDGSVTAGNASGVNDGACALLLASEDAVRRHGLTPRARILGSAAAGVPPRIMGIGPAPATQKLIARLGMDIGEFDT 320 Azoarcus evansii
AAQ61951 239 GVVTPDGTVTAGNASGINDGACALLLAGEEGIRRHGLVPRARILAAAAAGVAPRVMGMGPVPAINKALALAGLRLEQIDH 318 Chromobacterium vio...
Q43974   240 GVVKPEGSVTAGNASGINDGAAAVLIASDEAVAQYQLKARAKIIASTTVGIEPRIMGFAPAPAIKKLLKQANLTLDQMDV 319 Acinetobacter sp. ADP1
AAL02407 240 PVNGPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGIGPVPAVRKLLERLNLSVADFDV 319 Pseudomonas knackmu...
AAK24378 238 PIVREGGTVTAGNASGVNDGAVALVIASEDAVKRHGLTPRARITGYASAGVEPRVMGIGPVPAVRKLMAKTGLAIGDFDV 317 Caulobacter crescen...
P77525   240 APFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPVPATRRVLERAGLSIHDMDV 319 Escherichia coli K12
CAE12441 242 APFRAGGSVTAGNASGVNDGACALILASAEAVQRHGLTPRGKVIAAATAGVEPRIMGFGPAPATQKLLLKTGISLDEVDL 321 Photorhabdus lumine...
AAM35258 321 IELNEAFAAQALACTRAFGLADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEAGNGRFGLASMCIGVGQGVALAIE 400 Xanthomonas axonopo...
AAN39378 321 IELNEAFAAQGLAVLRQLGLPDDGEHVNPNGGAIAIGHPLGASGARLVTTALNQLETTGGRYGLATMCIGVGQGIALAFE 400 Azoarcus evansii
AAQ61951 319 IELNEAFAAQALAVLRELRLSDDDSRVNPNGGAIALGHPLGASGARLVSTAVYHLARTGGRYALCSMCVGVGQGIAMVIE 398 Chromobacterium vio...
Q43974   320 IELNEAFAAQALACTRDLGLADDDARVNPNGGAIALGHPLGASGARLVTTALNQLEQSGGKYALCSMCIGVGQGIALIIE 399 Acinetobacter sp. ADP1
AAL02407 320 IELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGHPLGASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVE 399 Pseudomonas knackmu...
AAK24378 318 VELNEAFAAQGLAVLRQLGLPDDGAHVNANGGAIALGHPLGASGARLVLTALRQLEASGGQRGLATLCIGVGQGAALAFE 397 Caulobacter crescen...
P77525   320 IELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLGMSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILE 399 Escherichia coli K12
CAE12441 322 LELNEAFASQALATLRALGVRDDDERVNPNGGAIALGHPLGMSGARLVTTALLELSLRQKRYAICTMCIGVGQGIAILIE 401 Photorhabdus lumine...
AAM35258 401 RL 402 Xanthomonas axonopodis pv. citri str. 306
AAN39378 401 RV 402 Azoarcus evansii
AAQ61951 399 RI 400 Chromobacterium violaceum ATCC 12472
Q43974   400 RV 401 Acinetobacter sp. ADP1
AAL02407 400 RV 401 Pseudomonas knackmussii B13
AAK24378 398 RV 399 Caulobacter crescentus CB15
P77525   400 RV 401 Escherichia coli K12
CAE12441 402 RV 403 Photorhabdus luminescens subsp. laumondii TTO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap