Conserved Protein Domain Family
pcaI_scoA_fam

?
TIGR02429: pcaI_scoA_fam 
3-oxoacid CoA-transferase, A subunit
Various members of this family are characterized as the A subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The B subunit represents a different clade in pfam01144, described by TIGR02428. The two are found in general as tandem genes and occasionally as a fusion.
Statistics
?
PSSM-Id: 131482
View PSSM: TIGR02429
Aligned: 6 rows
Threshold Bit Score: 386.427
Threshold Setting Gi: 32527387
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q01103         1 MINKTYESIASAVEGITDGSTIMVGGFGTAGMPSELIDGLIATGARDLTIISNNAGNGEIGLAALLMAGSVRKVVCSFPR 80  Pseudomonas putida
AAP86137       1 MIDKLYRTAREAMDDVPDGATIAIGGFGGAGMPDELIDALIEQGAKDLTVVSNNAGNGDTGLAALLKARRVRKLVCSFPR 80  Ralstonia eutro...
Q43973         1 MIDKSAATLTEALSQIHDGATILIGGFGTAGQPAELIDGLIELGRKNLTIVSNNAGNGDYGLAKLLKTGAVKKIICSFPR 80  Acinetobacter s...
CAG68538       1 MINKIINDIEPILKSIPDGSTIMTSGFGTTGQPEALLEALIDFAPKELTIINNNASSGPNGLTQLFTAGLVKKLICSYPK 80  Acinetobacter s...
tigr:BRA0638   1 -MDKTIGSAAEAVAEIGDGATVMIGGFGGSGAPIELIHALIDKGSKGLTVINNNAGNGRIGIAAMIDAGMVRKMICSFPR 79  Brucella suis 1330
CAE42075       1 MLNKTCESADEAVSVVESGATILISGFGDIGLPFELLHALARTSVKDLTIVSNNAGTGELGLSRLFRNRQVSRLIASFPS 80  Bordetella pert...
Q01103        81 QSDSYVFDELYRAGKIELEVVPQGNLAERIAAAGSGIGAFFSPTGYGTLLAEGKETREIDGRMYVLEMPLHADFALIKAH 160 Pseudomonas putida
AAP86137      81 QRDAYVFEELYRAGQIELEVVPQGTLAERLRAAGSGIGAFYTPTGYGTLLAEGKETRQIDGRGYVLEYPLPVDVALINAA 160 Ralstonia eutro...
Q43973        81 QADSYVFDELYRAGKIELEIVPQGNLACRIQAAGMGLGPIYTPTGFGTLLAEGKPTLNFDGKDYVLENPIKADFALIKAY 160 Acinetobacter s...
CAG68538      81 SISSTVFPDLYRAGKIELELVPQGNLACRIQAAGAGLGAVFTPTGYGTKIAEGKETRIINGKNYVLEYPLEADYAFIYAD 160 Acinetobacter s...
tigr:BRA0638  80 SSDPRAFTDRYLAGEIELELVPQSTLAERIRAGGAGIPAFYTPTAYGTELADGKVIAEFDGRPYVQERWLKADFALVKAH 159 Brucella suis 1330
CAE42075      81 QPDSHHYFAAYQEGLVDLELVPQGTLAERIRAAGAGLAGFFTPTGYGTELAQGKECRMFKGKGYVFEEALPGDFAFIKAH 160 Bordetella pert...
Q01103       161 KGDRWGNLTYRKAARNFGPIMAMAAKTAIAQVDQVVELGELDPEHIITPGIFVQRVVAVSGA 222 Pseudomonas putida
AAP86137     161 AADRWGNLIYNKTARNFAPVMAMAASQTIAAVARVCELGELDPEDVVTPGIFVSRVVLRDGA 222 Ralstonia eutropha H16
Q43973       161 KGDRWGNLVYRKSARNFGPIMAMAANVTIAQVSEVVALGELDPENVVTPGIFVQHVVPVQST 222 Acinetobacter sp. ADP1
CAG68538     161 KADRWGNLTYRKAARNFGPIMAKAAKTTIAQVNQTVELGDLDPECIITPGIFVQHVVRLGDI 222 Acinetobacter sp. ADP1
tigr:BRA0638 160 LGDSHGNLTYRMAARNFNPLMCMAAAKTIVQVSRIVPLGGIEPENVITPGIFVDRVVEIANP 221 Brucella suis 1330
CAE42075     161 VADAYGNFRYRRASRTFNPIMAMAARTTIAEAKQMVPVGSIDPDDVHTPGVFVDRIVEVRDE 222 Bordetella pertussis Tohama I
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap