Conserved Protein Domain Family
protocat_pcaD

?
TIGR02427: protocat_pcaD 
3-oxoadipate enol-lactonase
Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131480
View PSSM: TIGR02427
Aligned: 12 rows
Threshold Bit Score: 305.82
Threshold Setting Gi: 499341405
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC19106       3 ILHHVAY-GED-NDKTLVFIGSLGSTTAMWVPQLDALHKDFHVIAVDHRGHGSS--PLVNVTpTVADLATDVLETLDSLG 78  Corynebacterium...
BAB53359      18 TLHHRHL-KATgNARAIIFINSLGTDFRIWDDVVAALDGEMSLLVYDKRGHGLS--DIGDIS-SIDDHVDDLSGLIDHFG 93  Mesorhizobium l...
AAM39689      10 RLHYRLD-GTE-GRPWLTFCNSLGTDLHMWDVQLEALAPHYRILRYDRRGHGYS--ESPPGPySVADLGQDVIALWDALQ 85  Xanthomonas cam...
CAD15957      10 RLYHEFDdGPApAKPVLVLSNSLGTDLGMWAPQLEALRRHFRLLRYDTRGHGRS--SVPDAPfGVAQLGGDVLALLDHYD 87  Ralstonia solan...
AAK24382      10 RIYWRTD-GAA-DKPLLVLLNSIGCDLSLHDPVTPLLTPDFRVLRIDTRGHGAS--DAPSGDySLDLLADDVLAVMDAAG 85  Caulobacter cre...
WP_002965994  10 VVHYDLR-WNGnDKPVLVFINSLGTDFRIWNKVRARLGHDVSTLVYDKRGHGLS--DIGKTPyTIELLAQDLIALLDRLS 86  Brucella
WP_010976279  10 TIHYRVV-GAVtEKPALVFINSLGTDFRIWRDVVLRLAGDFAIVLYDKRGHGLS--DIGQVPySIEDHATDLAGLLDRLA 86  Sinorhizobium m...
WP_010973944  10 VIHYRAK-GLDsGKPVIAFINSLGTDFRIWDAVIEALGDDYAYVLHDKRGHGLS--DVGRAPySIDDHAGDLIALLDHLE 86  Agrobacterium f...
WP_011059666  10 ELHYQLE-GPE-GAPVLVLSNSLGTDLHMWDKQMAAFTRHFQVLRMDTRGHGRS--LVTEGPySIEQLGRDVVALLDALD 85  Pseudomonas pro...
WP_011242211  10 KLHFRVD-GDPdGAPV-VFINSLGTDLRLWDPILPHLPAGLRLIRYDKRGHGLS--DAPEGPyAMGTLVRDAERLLDLLD 85  Ruegeria pomeroyi
WP_004196557   2 RLHYRIDrAARaDAPWLVFSNSLGADLSMWAPQIGPMTAHFNLLRYDTRGHGHS--DAPAGSyTIEQLAGDVIGLLDHVG 79  pseudomallei group
WP_011031113   4 MLNHLSE-GPA-SAPPLLLGPSLGTSYALWDAVAPELSVRHRVIRWDLPGHGGSraDLIGPGaTVGDLADLVLALADSLG 81  Streptomyces co...
BAC19106      79 VEKFGVIGLSLGGAVAQYLAATS-DRVTAAAFLCTAAKFGEPQGWYDRAAATRENG---TASLSQAVIERWFSPGWLEAH 154 Corynebacterium...
BAB53359      94 WEKIVLCGLSVGGMIAQGLYARRpEIVEAMILCDTAHKIGTNESWNTRIAVVERKG---IQAIADGVLKVWFTPAFHTAR 170 Mesorhizobium l...
AAM39689      86 IARSDFCGLSIGGLTGQWLGLNVpQRLRRLVVCATAQKIGSADTWATRIEQVRHDG---LPVLIDATLQRWFTPHFALSH 162 Xanthomonas cam...
CAD15957      88 IEFALFCGLSMGGVTGLWLAAHHgERFPRMVVSNTAAQIGTQQSWNARIAQVEQRG---MGAITETVLERWFTDGYRVAA 164 Ralstonia solan...
AAK24382      86 AAKATICGTSLGGMIAMALASRApDRVEALVLACTSPAMDS-SSWEQRLAVIRAEG---LSAIVEAVMSRFFSDDFRALH 161 Caulobacter cre...
WP_002965994  87 IHKAVICGLSVGGLIAQGLYAARpDLVAGLVLSNTAHKIGTPEMWNARIDAIMQNG---LASILDATMPRWFTAAYRRPD 163 Brucella
WP_010976279  87 VKQAIVCGLSVGGLIAQSLYGRRpDLVRALVLSGTAHKIGTVEFWDARITAIEAHG---IEAVADGVLERWFTPAFRRPE 163 Sinorhizobium m...
WP_010973944  87 IKSAVIWGLSVGGLIAQGLYARRpDLVRALLLSNTAHRIGTTEMWNARIDKIAADG---LASLVDPVMERWFTPAFRQRE 163 Agrobacterium f...
WP_011059666  86 IQRAHFCGLSMGGLIGQWLGINAgERLHKLVVCNTAAKIGDPSVWNPRIETVLRDGqaaMVALRDASIARWFTSDFAEAH 165 Pseudomonas pro...
WP_011242211  86 IRDAAVVGLSIGGMIAQGLAVKRlDQVRALVLSNTAAKIGTKEMWQQRIAAVTAGG---IEALADTVMERWFSRGFR--A 160 Ruegeria pomeroyi
WP_004196557  80 VARAHFCGISMGGLTGAALAARHaKRVDRVVLSNTSAKIGSPEIWAPRARKARAEG---MAALADAVLPRWFTAAFFERE 156 pseudomallei group
WP_011031113  82 VERFAHAGVSLGGAVGLHLAVHHpERVSSLAVVCSSAHFNGAKPWEERAAQVRTEG---LARLADSADARWFVPGFTVPR 158 Streptomyces co...
BAC19106     155 PASKENYEHMIIDTPAEGYALACEALATWDFTDRLGEITVPVLTIAGADDPSTPPE-TLQIIADGVSGPGTAEVLSpGAH 233 Corynebacterium...
BAB53359     171 VAELDGYWNMMTRQAVAGYVGTCTAIRNADFTDAARRIAVPTLCIVGDQDGSTPPA-LVRSLAALIAGSRFEIIRD-AGH 248 Mesorhizobium l...
AAM39689     163 AQRLDMIAAAFVSTSPDGYIACCQAVADADFRGALEALEVPLLAIAGDDDPVCPPT-DLRDIAYAVPDGQYAQVP--GRH 239 Xanthomonas cam...
CAD15957     165 PARVDLVKAMLLATPPAGYNGNCAAIRDADLRAQLEAIRVPLLAIGGTHDISTPAA-QTRAIAQGVPGAQYVELS--AGH 241 Ralstonia solan...
AAK24382     162 PEVVETVRAGMLAQNPDGYCGCGAAIRDMALLDRLPKIAAPTLVLTGSKDVATPFEgHADRIVAAVPGARHAVIE--AAH 239 Caulobacter cre...
WP_002965994 164 NAAYQAYCNMFTRQPLEGYAATCAALRDADFTAAAHKISVPVRCVAGDQDGSTPPT-LVQELASLIPGAVFSQIAN-SGH 241 Brucella
WP_010976279 164 NLAFTGYRNMLVRQPVPGYVGTCAAIRDADFTEAAGRIAVPVLCVVGDQDGSTPPD-LVRSTADLIPGARFEVIRG-AGH 241 Sinorhizobium m...
WP_010973944 164 NAAYAGARNMLSQQPEAGYSGTCAAIRDADFTEQAGRIAVPALCIAGDQDGSTPPE-LVQSLAGLIPKSRFVTIAG-CGH 241 Agrobacterium f...
WP_011059666 166 PDQAKLITDMLAATSPQGYAANCAAVRDADFREQLGAIKVPTLVIAGTEDAVTPPS-GGHFIQQHVAGAEYAEFY--AAH 242 Pseudomonas pro...
WP_011242211 161 TPELALWRNMLVRQPVQGYAGCSAAIAGTDFYTPTSGLRLPTLGIAGDEDGSTPPD-LVRETVDLIPGSQFHLFRK-AGH 238 Ruegeria pomeroyi
WP_004196557 157 PRLIDVIRDTFNHTDKDGYAANCDALNAADLRDEAKGIAVPTLVVTGAHDLSTPPE-QGRALAASIAGAKHVEF-D-CAH 233 pseudomallei group
WP_011031113 159 LVR--DHR----EADPGAYAACCDALAAFDLRERVGEISAPTLLVAGREDPATPPS-HLREIADAVPGATLTEIPG-ASH 230 Streptomyces co...
BAC19106     234 VPTLERPEEVNALLAAHFR 252 Corynebacterium efficiens YS-314
BAB53359     249 IPCVEQPEALTALIRDFVA 267 Mesorhizobium loti MAFF303099
AAM39689     240 ICNLESPAAFNDVLLGFLQ 258 Xanthomonas campestris pv. campestris str. ATCC 33913
CAD15957     242 LANWEQAEAYTDVLVGFLT 260 Ralstonia solanacearum GMI1000
AAK24382     240 LPSLEAPAAFAGAVRGFLA 258 Caulobacter crescentus CB15
WP_002965994 242 IPCVEQPDAYTALLRDFLS 260 Brucella
WP_010976279 242 IPCVEQPEALWSVLRRFFR 260 Sinorhizobium meliloti
WP_010973944 242 IPCLEQPLVYAQAASIFLK 260 Agrobacterium fabrum
WP_011059666 243 LSNVQAGDAFSARVVDFLl 261 Pseudomonas protegens
WP_011242211 239 LPCVEHPAAYAERLAQFLR 257 Ruegeria pomeroyi
WP_004196557 234 ISNIECADGFNRTLIDFLT 252 pseudomallei group
WP_011031113 231 LAPAERPEAVLTALRAHFD 249 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap