Conserved Protein Domain Family
decarb_PcaC

?
TIGR02425: decarb_PcaC 
4-carboxymuconolactone decarboxylase
Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131478
View PSSM: TIGR02425
Aligned: 7 rows
Threshold Bit Score: 189.576
Threshold Setting Gi: 38490091
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD39557       3 EKQRYDAGMQVRRAVLGDAHVDRSLEKLND-FNGEFQEMITRHAWGDIWTRPGLPRHTRSLITIAMLIGMNRNDELKLHL 81  Pseudomonas putida
AAM35263       3 EDERYQAGMRERRRVLGDAHVDRALAARSD-FTEEFQDLITRYAWGGIWTRDGLPAHTRSLITLSMMIALGHDEEFKLHV 81  Xanthomonas axo...
BAB53360       7 NAARYRTGLAVRRAVLGDRHVDRAEVAATD-FDQPFQALITEAAWGTVWARPGLSKRERSIVTLALLAALGHDEEVALHV 85  Mesorhizobium l...
AAR21649       2 TQDRYDRGMQVRRRVLGDAHVDRAEAAKTA-LDQPFQELITEAAWGTVWASDRISLRERSMLTLALLAATGNFAEIPMHI 80  marine alpha pr...
AAC38246     265 RRAAHAQGMTVRRSVLGDAHVDRSVAGTTD-FTAPFQDFITRTAWGDIWSRPGLDHELRRLLTIAVLTAVGNEHELDMHI 343 Rhodococcus opacus
WP_010973943   7 KNERFEQGMKTRRAVLGDAHVNRAQTMTSD-FDQPFQQLITEGAWGTVWSGNHFTKRERSIVTIALLAALGQDEELAMHV 85  Agrobacterium f...
WP_010887847  35 PQEMFEQGLEKRRAVMGAEFVDRAFAGGEDaFGADFQRFMTEYAWGAVWGRGGLTDRERHMVTIGILAALGREKELAGHL 114 Deinococcus rad...
AAD39557      82 RAAANNGVTRDEIKEVLMQSAIYCGIPAANATFHMAESVWDELG 125 Pseudomonas putida
AAM35263      82 RAARNNGVTPAQIKEVLLQAAIYCGVPAANHAFALARPILEEQA 125 Xanthomonas axonopodis pv. citri str. 306
BAB53360      86 RATANTGATRDDICEAFLHVAIYAGVPAANRAFRIAKDVFSEMD 129 Mesorhizobium loti MAFF303099
AAR21649      81 RATARTGASQADVQEAFQHVAVYAGVPRANQALKLAKETYAAMA 124 marine alpha proteobacterium Y4I
AAC38246     344 RAALRAGVDADTIGEVLLHTAVYAGVPNSNLGFALGKQALADLS 387 Rhodococcus opacus
WP_010973943  86 RATVNTGATEADIREALLHVAIYAGVPAANHAFKIAKLALVSMK 129 Agrobacterium fabrum
WP_010887847 115 RATANTGVSERDLSDVLHQVAIYAGVPAALSAVNATKEMLAKRH 158 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap