2PCD,1EO2


Conserved Protein Domain Family
protocat_beta

?
TIGR02422: protocat_beta 
Click on image for an interactive view with Cn3D
protocatechuate 3,4-dioxygenase, beta subunit
This model represents the beta chain of protocatechuate 3,4-dioxygenase. The most closely related family outside this family is that of the alpha chain (TIGR02423), typically encoded in an adjacent locus. This enzyme acts in the degradation of aromatic compounds by way of p-hydroxybenzoate to succinate and acetyl-CoA. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131475
View PSSM: TIGR02422
Aligned: 14 rows
Threshold Bit Score: 394.405
Threshold Setting Gi: 11037226
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PCD_M        16 HPKALTPDYKTSIARSPRQALVSIP---QSISETTGPNFSHLGFGAHDHDLLL--NfnNGG-LPIGERIIVAGRVVDQYG 89  Pseudomonas putida
AAG27523      23 HPPYDTPAYIFTRKRAPSRPLRYIP---QTATELYGPVYGHESVRPEDSDLTR--Q--HDG-EPIGERIRITGRVIDEDG 94  Agrobacterium t...
AAS05048      32 QPLLDYPPYRATILRHPKQPLVAVd---PEAAELWAPCFGRDDVDPLDADLTA--G--HRG-EPIGERVVVAGRVVDEAG 103 Mycobacterium a...
BAC69414      32 HPPRDYAPYRSSVLRHPKQPLVAVHggdPETVELAGPVFGVTDITEIDNDLTR--Q--HRG-EPIGERMTVSGRLLDRDG 106 Streptomyces av...
CAF21063      13 YSPLHFPEYRTTIKRNPSNDLIMVP---SRLGESTGPVFGDRDLGDIDNDMTK--V--NGG-EAIGQRIFVHGRVLGFDG 84  Corynebacterium...
AAC38243      15 NAPLLFPEYKTTRLRSPKNDLILVP---QRLGEITGPVFGNADIAKGENDMTH--A--NGG-EAQGQRIIVHGRVLDSAG 86  Rhodococcus opacus
AAF65833      13 HPPALTPLYKTSVARSPRFAPIGAA---TSLSEETGPVFGHDLLGPKDNDLITnfA--APGeMAIGPRIVVQGTVRDEFG 87  Sagittula stell...
AAR21630      14 HPPALTPDYKTSVARSPRNALISLQ---QSVSEITGPVFGHNDIDPIDNDLIHnyA--KAGeSAIGERIIVHGRVLDENG 88  marine alpha pr...
WP_011083749  28 HPLPLSPEYKSSIKRAPNKPLIPMR---HTLSELTGPVYGHETVREGDNDLTT--Q--HTG-EPIGERIIVHGHVLDEDG 99  Bradyrhizobium ...
BAB53361      24 HPPALTPGYKSSVLRSPQKALLSFD---NSLSEIAGPVFGHAMLGELDADLIHnfA--RPGeSAIGERIIVHGRVLDERG 98  Mesorhizobium l...
2PCD_M        90 KPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPS 169 Pseudomonas putida
AAG27523      95 RGVPNALLEIWQANAAGRYIHKLDQHLAPLDPNFSGAGRTVTGSDGSYSFITIIPGAYPVVGLHNVWRPRHIHISLFGPS 174 Agrobacterium t...
AAS05048     104 RPVAGQLVEIWQANAAGRYRHQRDRHSAPLDPNFTGAGRCLTGPDGWYRFLTIKPGPYPWRNHHNAWRPAHIHFSVFGTA 183 Mycobacterium a...
BAC69414     107 RPVRGQLVEVWQANAAGRYAHLREQHPAPLDPNFTGVGRTLTDDQGRYTFTTIKPGPYPWGNHTNAWRPAHIHFSVFGTA 186 Streptomyces av...
CAF21063      85 KPVPHTLVEAWQANAAGRYRHKNDSWPAPLDPHFNGVARTLTDKDGQYHFWTVMPGNYPWGNHHNAWRPAHIHFSLYGRQ 164 Corynebacterium...
AAC38243      87 KPIPDTLIEVWQANAGGRYRHKMDSWPAPLDPHFNGVARCLTDKQGHYEFTTIKPGAYPWGNHHNAWRPAHIHFSLFGQA 166 Rhodococcus opacus
AAF65833      88 RPVPHTLVEVWQANAGGRYRHKKEGYLAPLDPNFGGCGRCITDENGFYEFRTVKPGPYPWPNGPDDWRPAHIHVSVFGHS 167 Sagittula stell...
AAR21630      89 RPVAGTLVEAWQANAGGRYRHKKDTYLAPIDPNFGGCGRTITDENGYYFFRTVKPGAYPWRNWVNNWRPAHIHMSIFGTS 168 marine alpha pr...
WP_011083749 100 RGVPNSLVEIWQANSCGRYVHVRDQHPAPLDPNFTGAGRTQSDASGYYRFVTIKPGAYPWGNHHNAWRPAHIHLSVFGHS 179 Bradyrhizobium ...
BAB53361      99 VGVPGVLIEFWQANAGGRYRHKKDGYLAPLDPNFGGCGRTITGEDGGYAFRTVKPGPYPWPNGPNDWRPAHIHFSVFGHG 178 Mesorhizobium l...
2PCD_M       170 IATKLITQLYFEGDPLIPMCPIVKSIANPEAVQqLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFEN 237 Pseudomonas putida
AAG27523     175 FLSRLVTQLYFEGDPLLRYDSIYNAAPDFSKRG-MVASLDLEATQSEWGLTYRFDIVLRGRNGNYFEE 241 Agrobacterium tumefaciens
AAS05048     184 FTQRLITQMYFPGDPMFELDPIFQSILDPAARRrLIAHYDHDLTQPEYATGYRWDIVLAGGGRTPTGA 251 Mycobacterium avium subsp. ...
BAC69414     187 FTQRLVTQMYFPSDPLFAYDPILRSVTDAAARNrLIATYQHDLSAPGFSLGYAWDIVLDGPSATWIEE 254 Streptomyces avermitilis MA...
CAF21063     165 FTERLVTQMYFPNDPLFFQDPIYNAVP-KGARErMIATFDYDETRENFALGYKFDIVLRGRNATPFE- 230 Corynebacterium glutamicum ...
AAC38243     167 FTQRLVTQMYFPDDPFFFQDPIYNSVP-EAARErMISTFDYDHTRDNWAVGFKFDIVLRGQDATPFED 233 Rhodococcus opacus
AAF65833     168 FAQRLITQMYFEGDPMIWQCPIVGTIPSREAIEtLVARLDRAGSIPMDALCYQFDITLRGRRQTMFEN 235 Sagittula stellata E-37
AAR21630     169 FSQRLITQCYFEGDPLIAKCPIVKTIPTQDGIDsLVAALDLNATIPLDSIAYKFDIVLRGRRSTLFEN 236 marine alpha proteobacteriu...
WP_011083749 180 FVTRLVTQMYFPADPLFPFDPIFNSVPDEKARArMVSSFDLENTQPEWALCYRFDIVLRGKNATPMES 247 Bradyrhizobium diazoefficiens
BAB53361     179 FAQRLITQMYFEGDPLIWKCPIVRGIADKAAIEaLTAILDTQATIPMDALAYKFDIVLRGRRSSLFEN 246 Mesorhizobium loti MAFF303099
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap