1OZG


Conserved Protein Domain Family
acolac_catab

?
TIGR02418: acolac_catab 
Click on image for an interactive view with Cn3D
acetolactate synthase, catabolic
Acetolactate synthase (EC 2.2.1.6) combines two molecules of pyruvate to yield 2-acetolactate with the release of CO2. This reaction may be involved in either valine biosynthesis (biosynthetic) or conversion of pyruvate to acetoin and possibly to 2,3-butanediol (catabolic). The biosynthetic type, described by TIGR00118, is also capable of forming acetohydroxybutyrate from pyruvate and 2-oxobutyrate for isoleucine biosynthesis. The family described here, part of the same larger family of thiamine pyrophosphate-dependent enzymes (pfam00205, pfam02776) is the catabolic form, generally found associated with in species with acetolactate decarboxylase and usually found in the same operon. The model may not encompass all catabolic acetolactate synthases, but rather one particular clade in the larger TPP-dependent enzyme family. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 131471
View PSSM: TIGR02418
Aligned: 7 rows
Threshold Bit Score: 953.811
Threshold Setting Gi: 4104436
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OZG_A        13 GADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSI-----RIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSN 87  Klebsiella pneu...
Q04524        13 GADLIVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSI-----RIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSN 87  Raoultella terr...
AAO05786       8 AAQMVIDTLKNNGVEYVFGIPGAKIDYLFNALEDDDI-----ELVVTRHEQNAAMIAQGIGRLTGKPGVAITTSGPGVSN 82  Staphylococcus ...
AAD02041       7 GADIVADSLTNHGIDLVFGIPGAKIDRLFTTLEHPAPgqkvpKLIVTRHEQNAVFMAQAFARITGKPGVTIVTSGPGVGN 86  Leuconostoc lactis
Q04789        16 GAELVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGP-----EIIVARHEQNAAFMAQAVGRLTGKPGVVLVTSGPGASN 90  Bacillus subtil...
WP_001191535  10 GAQLIAQQLEAIGVRYVFGIPGAKIDRLFDAIEDTKI-----QMIPVRHEANGAFMAGIMGRLSGRAGVTLATSGPGCGN 84  Vibrio cholerae
AAN00074       9 GADLIVDSLINHDVKYVFGIPGAKIDRVFDTLEDKGP-----ELIVARHEQNATFMAQAVGRITGEPGVVIATSGPGISN 83  Streptococcus a...
1OZG_A        88 LITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSL 167 Klebsiella pneu...
Q04524        88 LITGMATANSEGDPVVALGGAVKRADKAKLVHQSMDTVAMFSPVTKYAVEVTASDALAEVVSNAFRAAEQGRPGSAFVSL 167 Raoultella terr...
AAO05786      83 LTTGLLTATSEGDPVLAIGGQVKRNDLLRLTHQSIDNASLLRSSTKYSAEVQDPESLSEVITNAMRTATSGKNGASFISI 162 Staphylococcus ...
AAD02041      87 LVSGLMTASAESDPVVAIGGQVPRKDLYRLTHQSTKSVALFAPITNYSSEIQDPNNISEIIANAFAAANGAKKGAAFVSL 166 Leuconostoc lactis
Q04789        91 LATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFQPITKYSVEVQDVKNIPEAVTNAFRIASAGQAGAAFVSF 170 Bacillus subtil...
WP_001191535  85 LVTGVATANSEGDPMIAIGGAVKRDYQQKQTHQSMDTVSIFRSITKYSAEIQHVDATSEIMANAFRLAESGRQGACFISV 164 Vibrio cholerae
AAN00074      84 LATGLVTATDEGDAVLAIGGQVKRGDLLKRAHQSMNNVAMLEPITKYSAEVHDPNTLSETVANAYRLAKSGKPGASFISI 163 Streptococcus a...
1OZG_A       168 PQDVVDG-PVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAG 246 Klebsiella pneu...
Q04524       168 PQDIVDG-PASGSTLPASRAPQMGAAPDGAVDSVAQAIAAAKNPIFLLGLMASQPENSRALHRHAGKKPYSGHQHLSGAG 246 Raoultella terr...
AAO05786     163 PQDVISS-PVKADAISLCQKPHLGVPSEQEINEVIEAIKNSKFPVLLAGMRSSSQAETEAIRRLVQKTNLPVVETFQGAG 241 Staphylococcus ...
AAD02041     167 PQDVDDA-PVSVEALPPMPYAKQGAAALADLDWLAEQIKQAKLPVLLVGARGSDDDTVAALHKLLKQTTLPVVETFQGSG 245 Leuconostoc lactis
Q04789       171 PQDVVNE-VTNTKNVRAVAAPKLGPAADDAISAAIAKIQTAKLPVVLVGMKGGRPEAIKAVRKLLKKVQLPFVETYQAAG 249 Bacillus subtil...
WP_001191535 165 PQDVLADkTSSEIIIPSAYQPTAEADPD-SLQEAVERIQKAQRCVVLLGLHASHQATAEAVSAFLHKTQLPVVGTYQAAG 243 Vibrio cholerae
AAN00074     164 PQDVTDS-PVSVKAIKPLSAPKLGSASVLDINYLAQAINNAVLPVLLLGNGASSEGVTAAVRRLLDAVKLPVVETFQGAG 242 Streptococcus a...
1OZG_A       247 AVNQDNFSR-FAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGn-ATLVHIDVLPAYEERNYTPDVELVGDI 324 Klebsiella pneu...
Q04524       247 AVNQDNFAR-FAGRVGLFNNQAGDRLLRQADLIICIGYSPVEYEPAMWNSGt-ATLVHIDVLPAYEERNYVPDIELVGDI 324 Raoultella terr...
AAO05786     242 VISRELENH-FFGRVGLFRNQVGDELLRKSDLVITIGYDPIEYEASNWNKEldTKIINVDEEHAEITNYMQPVKELIGNI 320 Staphylococcus ...
AAD02041     246 VISRELEPEtFFGRIGFFRNQTGDKLLKQSDLVITVGYDAIEYEPRNWNKEndLNIVALDTTPVQIDNNFVPKRQLVGDL 325 Leuconostoc lactis
Q04789       250 TLSRDLEDQ-YFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNINgdRTIIHLDEIIADIDHAYQPDLELIGDI 328 Bacillus subtil...
WP_001191535 244 AVDINYYHH-FAGRVGLFNNQPGDVLLKEADLIITIGFNPIEYDPELWNSQr-CPIVHIDIEPAQYQIHYQPCLQIVGNI 321 Vibrio cholerae
AAN00074     243 IVSRELEDEtFFGRVGLFRNQPGDMLLKRADLVIAIGYDPIEYEARNWNAEisARIIVIDVEQAEIDTYFQPERELIGDM 322 Streptococcus a...
1OZG_A       325 AGTLNKLAQNIDHrLVLSPQAAEILRDRQHQRELLDRRGAQLNQFA--LHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIA 402 Klebsiella pneu...
Q04524       325 AATLEKLAQRIEHrLVLTPQAADILADRQRQRELLDRRGAQLNQFA--LHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIA 402 Raoultella terr...
AAO05786     321 AGTIDMISEHVNE-PFINQDHLDELEKLRGEITEATGIKATHK--EgvMHPVEIIETMQKVLTDDTTVTVDVGSHYIWMA 397 Staphylococcus ...
AAD02041     326 GQSLDLLTERVAG-YELPVDSQAVLKTLKADLRASDEPTYTPAQGHl-NHPLNIIKAIQAHVTDDMTVATDIGSHYIWMA 403 Leuconostoc lactis
Q04789       329 PSTINHIEHDAVK-VEFAEREQKILSDLKQYMHEGEQVPADWKSDR--AHPLEIVKELRNAVDDHVTVTCDIGSHAIWMS 405 Bacillus subtil...
WP_001191535 322 ASNLAALCRPLPGfTRLSPTALAILEEVTQQRHAIKAYPLRYQNAG--FHPLTLIKTMQAIIKPDTTLCLDMGSFHIWIA 399 Vibrio cholerae
AAN00074     323 AHTLDLLLPAIKG-YELPEGSKEYLKGLRNNIENVSDVKFDRDSAHglVHPLDLIDVLQENTTDDMTVTVDVGSHYIWMA 401 Streptococcus a...
1OZG_A       403 RYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVD-NGYNMVA 481 Klebsiella pneu...
Q04524       403 RYLYSFRARQVMISNGQQTMGVALPWAIGAWLVNPQRKVVSVSGDGGFLQSSMELETAVRLHANILHIIWVD-NGYNMVA 481 Raoultella terr...
AAO05786     398 RKYRSYNPRHLLFSNGMQTLGVALPWAISAALVRPNTQVVSVAGDGGFLFSGQELETAVRKNLNIIQLIWND-GRYNMVE 476 Staphylococcus ...
AAD02041     404 RHFKSYVARHFLISNGMQTLGVGLPWAMTAAMLRPNAKAVSVSGDGGFFFSSMELETAVRLKLNTVHIVWNDnAHYDMVK 483 Leuconostoc lactis
Q04789       406 RYFRSYEPLTLMISNGMQTLGVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWND-STYDMVA 484 Bacillus subtil...
WP_001191535 400 RYLSCFRARQMLVSNGQQTMGVALPWAIAASLLKPGHKVVSVSGDGGFMQSSMELETAVRLKCNIVHIIWVD-NAYNMVE 478 Vibrio cholerae
AAN00074     402 RYFKSYEARHLLFSNGMQTLGVALPWAISAALLRPNTKVISVSGDGGFLFSAQELETAVRLHLPIVHIIWND-GKYNMVE 480 Streptococcus a...
1OZG_A       482 IQEEKKYQ-RLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAA--MDVDGPAVVAIPVDYRDNPLLMG 551 Klebsiella pneumoniae
Q04524       482 IQEQKKYQ-RLSGVEFGPVDFKVYAEAFGACGFAVESAEALEPTLRAA--MDVDGPAVVAIPVDYRDNPLLMG 551 Raoultella terrigena
AAO05786     477 FQEEMKYK-RSSGVEFGPVDYVKYAESFGAKGLRVTNQEELEAALKEG--YETDGPVLIDIPVNYADNVKLST 546 Staphylococcus epiderm...
AAD02041     484 FQEEMKYDgRSAGVDFGNIDLVKYAESFGAKGLRVNTPDELNAVLDEA--FASEGPVVVDIPVDYSHNFELGS 554 Leuconostoc lactis
Q04789       485 FQQLKKYN-RTSAVDFGNIDIVKYAESFGATGLRVESPDQLADVLRQG--MNAEGPVIIDVPVDYSDNINLAS 554 Bacillus subtilis subs...
WP_001191535 479 MQEVQKYH-RAAGVKFGPIDFKAYAESFGARGYAITQPDQLLPTLRQA--MEVEGPAVVAIPVDYSDNPKLMQ 548 Vibrio cholerae
AAN00074     481 FQEEMKYG-RSSGVDFGPVDFVKYAESFGAKGYRVDSKDSFEETLKQAliDAENGPVLIDVPIDYKDNVTLGE 552 Streptococcus agalacti...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap