Conserved Protein Domain Family
fruct_sucro_rep

?
TIGR02417: fruct_sucro_rep 
D-fructose-responsive transcription factor
Members of this family belong the lacI helix-turn-helix family (pfam00356) of DNA-binding transcriptional regulators. All members are from the proteobacteria. Characterized members act as positive and negative transcriptional regulators of fructose and sucrose transport and metabolism. Sucrose is a disaccharide composed of fructose and glucose; D-fructose-1-phosphate rather than an intact sucrose moiety has been shown to act as the inducer. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131470
View PSSM: TIGR02417
Aligned: 5 rows
Threshold Bit Score: 499.277
Threshold Setting Gi: 24982197
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P21168     2 KLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIAN 81  Escherichia coli
AAN66417   2 KLSDIARLAGVSVTTASYVINGKAEQQRISNSTVERVRAVVEAHGFTPNPQAAGLRSRHTRTLGFILPDLENPSYARIAK 81  Pseudomonas putida ...
BAC62157   2 TLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQKKVMAVVDEYNYKPDHAASSLRAGNSRSFGLIIPDLENTSYARLAK 81  Vibrio parahaemolyt...
P37076     7 TIKDIAELAGVSKATASLVLNGRGKELRVAQETRERVLAIAREQHYQPSIHARSLRDNRSHTIGLVVPEITNYGFAVFSH 86  Klebsiella pneumoniae
AAK03931  10 TLSDIAKCCGLSTTTVSMILNNRGEEFKIKAETCQRVKAIAEQQGYRANVYAKSLKMQRSNVIGFVIPDLTNYGFACTAK 89  Pasteurella multoci...
P21168    82 YLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVG 161 Escherichia coli
AAN66417  82 QLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVIS 161 Pseudomonas putida ...
BAC62157  82 LIEQNSRKAGYQILIGCSDDDPETEKKVAEALISRRIDALFVASGMPSANEYYLKLQNSGTPVIALDRPMDDEHFCCVIS 161 Vibrio parahaemolyt...
P37076    87 ELETLCREAGVQLLISCTDENPGQESVVVNNMIARQVDGLIVASCMH-SDADYQKLS-EQLPVVLFDRSPSDSALPLVMT 164 Klebsiella pneumoniae
AAK03931  90 ILEKQCRENGLQLIIACSDDNPQQEKLAIERLLDRQIDFLITAPTHQ-DPSYYQKIG-QHTPILQLDRYVPDLALNYVIS 167 Pasteurella multoci...
P21168   162 ADQDDAEMLAEELRKFP-AETVLYLGALPELSVSFLREQGFRTAWKDD--PREVHFLYANSYEREAAAQLFEKWLETHP- 237 Escherichia coli
AAN66417 162 DDRDASRQLAASLLSSA-PRSIALIGARPELSVSQARAGGFDEALQGY--TGEVRRYQGEAFSRECGQRLMQQLIDDLGg 238 Pseudomonas putida ...
BAC62157 162 EDFDAAFELTESVLSPE-IKTIGLIGALQDLQVSKERELGFRSACQKD--DTAMTVGYGLHFSREEGKKVLDKWVQADS- 237 Vibrio parahaemolyt...
P37076   165 DSVTPTAELISRIAPQH-ADEFWFLGGQPRLSPSRDRLAGFTQGLAQAgiTLRPEWVINGNYHPSSGYEMFAALCARLGr 243 Klebsiella pneumoniae
AAK03931 168 NDSEHITALICRLCDQYqLTEFMYFGGQRTLSPSESRLAGFLQGLKQAnlNLKKEWILHRTYQPESGYQMLAETEAKLGr 247 Pasteurella multoci...
P21168   238 MPQALFTTSFALLQGVMDVTLRRDg---KLPSDLAIATFGDNELLDFLQCPVLAVAQRHRDVAERVLEIVLASLDePRKP 314 Escherichia coli
AAN66417 239 LPDALVTTSYVLLQGVFDTLQARP----VDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIE-EKRY 313 Pseudomonas putida ...
BAC62157 238 LPDAIVTTSYTLLEGVLDVMLEKP----ELMSQVRLATFGDNRLLDFLPVKINSLPQQFELIADSAMELALNAS--AKRY 311 Vibrio parahaemolyt...
P37076   244 PPKALFTAACGLLEGVLRYMSQHH----LLDSNIHLASFDDHYLYDSLSLRIDTVQQDNRQLAWHCYDLLSQLID-GQAP 318 Klebsiella pneumoniae
AAK03931 248 LPQAIFTASYTLLEGVLRYLTEQKkmdlLLNRQLHLATFDDHDILNALPFHIHSIKQNHPQLAHQIFQHIMRYFA-GKK- 325 Pasteurella multoci...
P21168   315 KPGLTRIKRNLYRRG 329 Escherichia coli
AAN66417 314 EPGVHAVGRTFKQRI 328 Pseudomonas putida KT2440
BAC62157 312 KPGVELIPRKIVKRQ 326 Vibrio parahaemolyticus RIMD 2210633
P37076   319 EPLQRYLPATLQIRH 333 Klebsiella pneumoniae
AAK03931 326 SPNQK-IDCDVIYRD 339 Pasteurella multocida subsp. multocida str. Pm70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap