1N5W,1FFU


Conserved Protein Domain Family
CO_dehy_Mo_lg

?
TIGR02416: CO_dehy_Mo_lg 
Click on image for an interactive view with Cn3D
carbon-monoxide dehydrogenase, large subunit
This model represents the large subunits of group of carbon-monoxide dehydrogenases that include molybdenum as part of the enzymatic cofactor. There are various forms of carbon-monoxide dehydrogenase; Salicibacter pomeroyi DSS-3, for example, has two forms. Note that, at least in some species, the active site Cys is modified with a selenium attached to (rather than replacing) the sulfur atom. This is termed selanylcysteine, and created post-translationally, in contrast to selenocysteine incorporation during translation as for many other selenoproteins. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131469
View PSSM: TIGR02416
Aligned: 5 rows
Threshold Bit Score: 1474.39
Threshold Setting Gi: 500046444
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N5W_B        29 EDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTAADLKPLNLHYMPTLAGDVQAVLAD 108 Oligotropha car...
P19913        26 EDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAEDLKPLKLHWMPTLAGDVAAVLAD 105 Hydrogenophaga ...
WP_011727162  31 EDPRFIRGRGNYVDDVKLPGMLHLAILRSPYAHATINSIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLSNDVQAVLAT 110 Mycobacterium s...
P19919        29 EDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTAADLKPLNLHYMPTLAGDVQAVLAD 108 Oligotropha car...
1FFU_B        26 EDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAEDLKPLKLHWMPTLAGDVAAVLAD 105 Hydrogenophaga ...
1N5W_B       109 EKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLPVLVDPFKAMEPDAPLLREDIKDKMTGAHGARKHHNHIFRWEIGD 188 Oligotropha car...
P19913       106 EKVHFQMQEVAIVIADDRYIAADAVEAVKVEYDELPVVIDPIDALKPDAPVLREDLAGKTSGAHGPREHHNHIFTWGAGD 185 Hydrogenophaga ...
WP_011727162 111 DKVRFQGQEVAFVVAEDRYSARDALELIDVDYEPLDPVIDARHALDPGAPVIRTDLDGKTD---------NHCFDWETGD 181 Mycobacterium s...
P19919       109 EKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLPVLVDPFKAMEPDAPLLREDIKDKMTGAHGARKHHNHIFRWEIGD 188 Oligotropha car...
1FFU_B       106 EKVHFQMQEVAIVIADDRYIAADAVEAVKVEYDELPVVIDPIDALKPDAPVLREDLAGKTSGAHGPREHHNHIFTWGAGD 185 Hydrogenophaga ...
1N5W_B       189 KEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASMDKIKGELTLWGTFQAPHVIRTVVSLISGLPEHKIHVIAPDIG 268 Oligotropha car...
P19913       186 KAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASFDPIKGDLTTYITSQAPHVVRTVVSMLSGIPESKVRIVSPDIG 265 Hydrogenophaga ...
WP_011727162 182 AAATDAVFAKADVVVKQEMVYPRVHPAPMETCGAVADLDPVTRKLTLWSTTQAPHAHRTLYALVAGLPEHKIRVISPDIG 261 Mycobacterium s...
P19919       189 KEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASMDKIKGELTLWGTFQAPHVIRTVVSLISGLPEHKIHVIAPDIG 268 Oligotropha car...
1FFU_B       186 KAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASFDPIKGDLTTYITSQAPHVVRTVVSMLSGIPESKVRIVSPDIG 265 Hydrogenophaga ...
1N5W_B       269 GGFGNKVGAYSGYVCAVVASIVLGVPVKWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADP 348 Oligotropha car...
P19913       266 GGFGNKVGIYPGYVCAIVASIVLGRPVKWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADP 345 Hydrogenophaga ...
WP_011727162 262 GGFGNKVPIYPGYVCAIVGSLLLGKPVKWMEDRSENLTSTGFARDYIMVGEIAATRDGKILAIRSNVLADHGAFNGTAAP 341 Mycobacterium s...
P19919       269 GGFGNKVGAYSGYVCAVVASIVLGVPVKWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADP 348 Oligotropha car...
1FFU_B       266 GGFGNKVGIYPGYVCAIVASIVLGRPVKWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADP 345 Hydrogenophaga ...
1N5W_B       349 SKWPAGFMNICTGSYDMPVAHLAVDGVYTNKASGGVAYRCSFRVTEAVYAIERAIETLAQRLEMDSADLRIKNFIQPEQF 428 Oligotropha car...
P19913       346 TKFPAGLFHICSGSYDIPRAHCSVKGVYTNKAPGGVAYRCSFRVTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRKEQF 425 Hydrogenophaga ...
WP_011727162 342 VKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCLAYELKMDPAQLRLQNLLKAEQF 421 Mycobacterium s...
P19919       349 SKWPAGFMNICTGSYDMPVAHLAVDGVYTNKASGGVAYRCSFRVTEAVYAIERAIETLAQRLEMDSADLRIKNFIQPEQF 428 Oligotropha car...
1FFU_B       346 TKFPAGLFHICSGSYDIPRAHCSVKGVYTNKAPGGVAYXXSFRVTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRKEQF 425 Hydrogenophaga ...
1N5W_B       429 PYMAPLGWEYDSGNYPLAMKKAMDTVGYHQLRAEQKAKQeafKRGE---TREIMGIGISFFTEIVGAGPSKNCDILGVSM 505 Oligotropha car...
P19913       426 PYTTQFGFEYDSGDYHTALKKVLDAVDYPAWRAEQAARR---ADPN---SPTLMGIGLVTFTEVVGAGPSKMCDILGVGM 499 Hydrogenophaga ...
WP_011727162 422 PYTSKTGWVYDSGDYEKTMRLAMEMVDYEGLRAEQAEKR---KRGE------LMGIGMSFFTEAVGAGPRKDMDILGLGM 492 Mycobacterium s...
P19919       429 PYMAPLGWEYDSGNYPLAMKKAMDTVGYHQLRAEQKAKQ---EAFKrgeTREIMGIGISFFTEIVGAGPSKNCDILGVSM 505 Oligotropha car...
1FFU_B       426 PYTTQFGFEYDSGDYHTALKKVLDAVDYPALRAEQAARR---ADPN---SPTLMGIGLVTFTEVVGAGPSKMCDILGVGM 499 Hydrogenophaga ...
1N5W_B       506 FDSAEIRIHPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSTPTAGAATAVAAR 585 Oligotropha car...
P19913       500 FDSCEIRIHPTGSAIARMGTITQGQGHQTTYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVAGAAIALAAR 579 Hydrogenophaga ...
WP_011727162 493 ADGCELRVHPTGKAVVRLSVQSQGQGHETTFAQIVAEELGIPPEDIDVVHGDTDQTPFGLGTYGSRSTPVSGAAAALVAR 572 Mycobacterium s...
P19919       506 FDSAEIRIHPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSTPTAGAATAVAAR 585 Oligotropha car...
1FFU_B       500 FDSCEIRIHPTGSAIARMGTITQGQGHQTTYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVAGAAIALAAR 579 Hydrogenophaga ...
1N5W_B       586 KIKAKAQMIAAHMLEVHEGDLEWDVDRFRVKGLPEKFKTMKELAWASYNS--PPPNLEPGLEAVNYYDPPNMTYPFGAYF 663 Oligotropha car...
P19913       580 KIHAKARKIAAHMLEVNENDLDWEVDRFKVKGDDSKFKTMADIAWQAYHQ--PPAGLEPGLEAVHYYDPPNFTYPFGIYL 657 Hydrogenophaga ...
WP_011727162 573 KVRDKAKIIAAGMLEASIADLEWDKGSFHIKGDPSASVTIADIAMRAHGAgdLPEGLEGGLDAQICYNPSNLTYPYGAYF 652 Mycobacterium s...
P19919       586 KIKAKAQMIAAHMLEVHEGDLEWDVDRFRVKGLPEKFKTMKELAWASYNS--PPPNLEPGLEAVNYYDPPNMTYPFGAYF 663 Oligotropha car...
1FFU_B       580 KIHAKARKIAAHMLEVNENDLDWEVDRFKVKGDDSKFKTMADIAWQAYHQ--PPAGLEPGLEAVHYYDPPNFTYPFGIYL 657 Hydrogenophaga ...
1N5W_B       664 CIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGNVLGASFMDFFLPTAVETPKWE 743 Oligotropha car...
P19913       658 CVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGNLLGNTLMDYFLPTAVETPHWE 737 Hydrogenophaga ...
WP_011727162 653 CVVDIDPGTAVVKVRRFVAVDDCGTRINPMIIEGQIHGGLVDGIGMALMEMIAFDEDGNCLGGSLMDYLIPTAMEVPHFE 732 Mycobacterium s...
P19919       664 CIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGNVLGASFMDFFLPTAVETPKWE 743 Oligotropha car...
1FFU_B       658 CVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGNLLGNTLMDYFLPTAVETPHWE 737 Hydrogenophaga ...
1N5W_B       744 TDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDAYAFLNAGHIQMPHDAWRLWKV 801 Oligotropha carboxidovorans OM5
P19913       738 TDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFAHVGVTHLDMPHTSYRVWKS 795 Hydrogenophaga pseudoflava
WP_011727162 733 TGHTVTPSPHHPIGAKGIGESATVGSPPAVVNAVVDALAPYGVRHADMPLTPSRVWEA 790 Mycobacterium smegmatis
P19919       744 TDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDAYAFLNAGHIQMPHDAWRLWKV 801 Oligotropha carboxidovorans OM5
1FFU_B       738 TDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFAHVGVTHLDMPHTSYRVWKS 795 Hydrogenophaga pseudoflava
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap