1GEG,3A28


Conserved Protein Domain Family
23BDH

?
TIGR02415: 23BDH 
Click on image for an interactive view with Cn3D
acetoin reductases
One member of this family, as characterized in Klebsiella terrigena, is described as able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also called capable of irreversible reduction of diacetyl with NADH to acetoin. Blomqvist, et al. decline to specify either EC 1.1.1.4 which is (R,R)-butanediol dehydrogenase, or EC 1.1.1.5, which is acetoin dehydrogenase without a specified stereochemistry, for this enzyme. This enzyme is a homotetramer in the family of short chain dehydrogenases (pfam00106). Another member of this family, from Corynebacterium glutamicum, is called L-2,3-butanediol dehydrogenase (). [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 131468
View PSSM: TIGR02415
Aligned: 8 rows
Threshold Bit Score: 403.756
Threshold Setting Gi: 4062842
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GEG_A     3 KVALVTGAGQGIGKAIALRLVKDGFAVAIADYN--DATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGF 80  Klebsiella pneumoni...
Q8CQD2     3 KTAIITGAAGGLGKGIAERLANDGFNIVLQDIN--EALLLETEKEFKEKGYQAVAYKSDVSKKKEQEELVQFAVTEFGQL 80  Staphylococcus epid...
CAG85734   3 RTALITGGARGIGEAISKRLAKDGLNVVICDLQnqNKAAMKTIQEINQFGGNAVFYPLDVRVKSQIEKTIDNAYEKFGTF 82  Debaryomyces hansen...
Q99X89     5 KVALVTGGAQGIGFKIAERLVEDGFKVAVVDFN--EEGAKAAALKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDF 82  Staphylococcus aure...
Q48436     3 KVALVTGAGQGIGKAIALRLVKDGFAVAIADYN--DATAKAVASEINQAGGRAMAVKVDVSDRDQVFAAVEQARKTLGGF 80  Klebsiella pneumoniae
CAB59826   3 KLAIVTGSGQGIGEGIVYRLAKDGFAVAVADIN--PQTAKNVAKTLIDKGFEAKAYVLDVANRSAVFQLIEQAVSDFGEL 80  Lactococcus lactis ...
BAA36159   3 KVAMVTGGAQGIGRGISEKLAADGFDIAVADLPqqEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGF 82  Corynebacterium glu...
3A28_C     3 KVAMVTGGAQGIGRGISEKLAADGFDIAVADLPqqEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGF 82  Corynebacterium glu...
1GEG_A    81 DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHG-GKIINACSQAGHVGNPELAVYSSSKFAV 159 Klebsiella pneumoni...
Q8CQD2    81 DVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQAAANQFIKQKSK-GKIINACSIAGHESYEVLGTYSATKHSV 159 Staphylococcus epid...
CAG85734  83 DVMVNNAGICLVNSFADITEDELEKQWAVNVKGVLFGMQAAARKFKDVQNRtGRIINAASISGQLGMPNQGAYCSTKFAV 162 Debaryomyces hansen...
Q99X89    83 HVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG-GKIINATSQAGVEGNPGLSLYCSTKFAV 161 Staphylococcus aure...
Q48436    81 DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHG-GKIINACSQAGHVGNPELAVYSSSKFAV 159 Klebsiella pneumoniae
CAB59826  81 AVFVNNAGVAFIDSIIDSDSERVERLFDVNIKGTYWGIQAAATQFKKQGHG-GRIINAASLASVEGSALQSAYSASKFAI 159 Lactococcus lactis ...
BAA36159  83 DVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVK-GKIINAASIAAIQGFPILSAYSTTKFAV 161 Corynebacterium glu...
3A28_C    83 DVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVK-GKIINAASIAAIQGFPILSAYSTTKFAV 161 Corynebacterium glu...
1GEG_A   160 RGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAG-KPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPD 238 Klebsiella pneumoni...
Q8CQD2   160 RSFTQTAAKELADKGITVNAYCPGVAKTEMWDRIDEEMVKLDDsLEIGDAFEAFSSEIKLGRYQEPSDVANLVSFLASND 239 Staphylococcus epid...
CAG85734 163 KALTQTAAQELAADGITVNSYCPGTVETEMQRGILEKEVELGIsKEESRKIHYDSSAIKG--TIMPDDVAGLVSFLASSN 240 Debaryomyces hansen...
Q99X89   162 RGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAG-KPEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKD 240 Staphylococcus aure...
Q48436   160 RGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAG-KPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPD 238 Klebsiella pneumoniae
CAB59826 160 RGLTQSAAKELAKDYITVNAYNPGIVRTAMRDEIDKKTAQIKG-ISIEQQQQNCLNEIYLGREGRPEDVAEVVAWFASDA 238 Lactococcus lactis ...
BAA36159 162 RGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAELSKING-KPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASEN 240 Corynebacterium glu...
3A28_C   162 RGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAELSKING-KPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASEN 240 Corynebacterium glu...
1GEG_A   239 SDYMTGQSLLIDGGMVFN 256 Klebsiella pneumoniae 342
Q8CQD2   240 SDYITGQSILTDGGLVYR 257 Staphylococcus epidermidis ATCC 12228
CAG85734 241 SNFITGQSIIVDGGLVYR 258 Debaryomyces hansenii CBS767
Q99X89   241 SDYITGQTIIVDGGMRFR 258 Staphylococcus aureus subsp. aureus Mu50
Q48436   239 SDYMTGQSLLIDGGMVFN 256 Klebsiella pneumoniae
CAB59826 239 AEYITGQSILVDGGMRFN 256 Lactococcus lactis subsp. cremoris MG1363
BAA36159 241 SNYVTGQVMLVDGGMLYN 258 Corynebacterium glutamicum
3A28_C   241 SNYVTGQVMLVDGGMLYN 258 Corynebacterium glutamicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap