Conserved Protein Domain Family
ectoine_ThpD

?
TIGR02408: ectoine_ThpD 
ectoine hydroxylase
Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.
Statistics
?
PSSM-Id: 131461
View PSSM: TIGR02408
Aligned: 3 rows
Threshold Bit Score: 516.369
Threshold Setting Gi: 489992292
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE33709      21 ARQDPVVYGEGKFADALSADQVQSYERDGFLLLENLFSDEEVAALLAEVERMTRDPAIVRREEAITEPGSNAVRSIFMVH 100 Bordetella bron...
AAS02097      21 PRQDPVIWSAPGAPGPVAAKDLQGYEHDGFLTVDQLIAPDEVAVYQAELNRLISDPAVRADERSIVEKQSQNVRSVFEVH 100 Streptomyces an...
WP_003895349  32 PRADPTVWGS-EADGPLNQKNLDHFSSQGYLVRHGTVTNDWLPHLRQEMDRIAAD--LDHDDPRVIREPGGSIRSIFEPH 108 Mycobacterium s...
CAE33709     101 VLSPILGRLVRDPRLANAARQILGSEVYVHQSRANMKPGFKGKEFYWHSDFETWHVEDGMPSMRALSCSVLLTDNNETNG 180 Bordetella bron...
AAS02097     101 RISEVFAGLVRDERVVGRARQILGSDVYVHQSRINVKPGFGATGFYWHSDFETWHAEDGLPNMRTVSVSIALTENFDTNG 180 Streptomyces an...
WP_003895349 109 LLSDLVAQVVRLDTVLPVARQLLGSDVYIHQARINMMPGFTGTGFYWHSDFETWHAEDGMPAIRAVSCSIALTRNYPYNG 188 Mycobacterium s...
CAE33709     181 PLMLVPGSHRQFISCVGETPRDHYKQSLKKQEYGVPDPVSLQLLAEQGGISTMTGKAGSVVFFDCNTMHGSNSNISPWPR 260 Bordetella bron...
AAS02097     181 GLMIMPGSHKTFLGCAGETPKDNYKKSLQMQDAGTPSDEALTKMADRHGIRLFTGRAGSATWFDCNAMHGSGDNITPYAR 260 Streptomyces an...
WP_003895349 189 SLMVIPGSHQTFYPCVGETPQDNHDTSLVAQTVGVPDETTLTKAVDHAGIDQFTGAAGSALWFDANLLHGSGSNITPLPR 268 Mycobacterium s...
CAE33709     261 ANVFMVYNSMENTLNPPKYGLNPRPEHIATRQaFKAVR 298 Bordetella bronchiseptica RB50
AAS02097     261 SNVFIVFNSVENAAQEPFAAPIRRPEFIGARD-FTPVK 297 Streptomyces anulatus
WP_003895349 269 SNVFLVFNSVDNALEEPFAAPRRRPEYLAARR-VAPVT 305 Mycobacterium smegmatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap